KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332736
Entry
4332736           CDS       T01015                                 
Name
(RefSeq) hydroxyacylglutathione hydrolase cytoplasmic
  KO
K01069  hydroxyacylglutathione hydrolase [EC:3.1.2.6]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    4332736
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.6  hydroxyacylglutathione hydrolase
     4332736
SSDB
Motif
Pfam: HAGH_C Lactamase_B Lactamase_B_2 Lactamase_B_3
Other DBs
NCBI-GeneID: 4332736
NCBI-ProteinID: XP_015627797
UniProt: B9F8A3 Q10LW8
LinkDB
Position
3:complement(12263460..12266488)
AA seq 258 aa
MKIIPVACLEDNYAYLIVDESTKSAAAVDPVEPEKVLAAAAEVGVRIDCVLTTHHHWDHA
GGNEKMAQSVPGIKVYGGSLDNVKGCTDQVENGTKLSLGKDIEILCLHTPCHTKGHISYY
VTSKEEEDPAVFTGDTLFIAGCGRFFEGTAEQMYQSLCVTLGSLPKPTQVYCGHEYTVKN
LKFILTVEPDNEKVKQKLEWAQKQREANQPTIPSTIGEEFETNTFMRVDLPEIQAKFGAK
SPVEALREVRKTKDNWKS
NT seq 777 nt   +upstreamnt  +downstreamnt
atgaagatcatcccggtcgcttgcctggaggacaactatgcctacctaatcgtggacgag
agcaccaagtcggcggcggccgtcgaccccgtggagccggagaaggtgcttgcggcggcc
gcggaggtcggcgtccgcatcgactgcgtactcaccacccaccatcactgggatcatgct
ggtggcaatgaaaagatggcgcagtcagtgccagggattaaggtctatggaggatccctg
gacaatgtgaaaggatgcactgatcaggtggagaatggaaccaaattgtcccttgggaag
gacattgagatactatgcctgcacacaccgtgccacacaaaaggacatatcagctattac
gtcactagtaaagaggaggaagatccagcagtgtttactggagacaccttgttcattgct
ggttgtgggagattttttgagggcactgcagagcaaatgtaccaatccctttgtgtaaca
ctgggctcgctgcctaagccaactcaagtttactgcgggcatgagtacactgtgaagaac
ctgaaattcatactgacggtcgagccagataacgaaaaagtgaagcagaaactagaatgg
gctcaaaagcagcgtgaagcaaaccaaccaactattccatcaactataggagaggaattt
gagacaaacaccttcatgcgtgttgatctgccagaaatacaggcaaagtttggtgccaag
tcgccagttgaggccctgcgagaagttaggaagaccaaggataactggaaaagttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347581
Entry
4347581           CDS       T01015                                 
Name
(RefSeq) probable hydroxyacylglutathione hydrolase 2, chloroplastic
  KO
K01069  hydroxyacylglutathione hydrolase [EC:3.1.2.6]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    4347581
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.6  hydroxyacylglutathione hydrolase
     4347581
SSDB
Motif
Pfam: HAGH_C Lactamase_B Lactamase_B_2 TAXi_C HMGL-like DUF4362
Other DBs
NCBI-GeneID: 4347581
NCBI-ProteinID: XP_015612445
UniProt: Q69MU0 Q0J0C8
LinkDB
Position
9:complement(20122341..20127424)
AA seq 336 aa
MRMLSKACSLVASSLPRCSSSAAPTIRGQPSLLPSVRKEWLGKPLLYGIGTLLVMPLRTL
HGVGRMFGAGRFLCNMTSVSSSLQIELVPCLQDNYAYILHDVDTGTVGVVDPSEATPIIN
ALEKRNQNLTYILNTHHHYDHTGGNLELKAKYGAKVIGSAKDRDRIPGIDITLSEGDTWM
FAGHQVLVMETPGHTSGHVCYHFPGSGAIFTGDTLFSLSCGKLFEGTPQQMYSSLQKIIA
LPDETRVYCGHEYTLSNSKFALSIEPGNKDLQEYAANAADLRKRNTPTVPTTIGREKQCN
PFLRTSSPEIKNTLSIPDHFDDARVLEVVRRAKDNF
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgcggatgctgtccaaggcgtgctcgctcgtggcctcctccctcccgcggtgctcatcc
tccgctgcccccacgatcagagggcagccgtcgttgctgccaagcgtgcgcaaggaatgg
cttggcaagccgctgctgtacggaatcggcacgctgctcgtcatgcctctgaggacgctg
cacggggtgggacggatgtttggcgctgggcggttcctctgcaacatgaccagcgtctcg
tcgtcgctgcaaattgagctcgtaccctgccttcaagataactatgcttacatcctacat
gatgttgatactggaacagttggagttgtggacccttctgaagcaacgccaatcataaat
gcactagaaaaaagaaaccagaacttgacctacatactgaacacccatcatcactatgac
catactggtggcaacttggaactgaaggcaaaatatggtgcaaaggtgattggttctgca
aaggatagggatagaattccaggcattgacataactcttagtgagggtgacacatggatg
tttgctggtcatcaagttcttgtaatggaaactcctggtcatacatcaggtcatgtgtgc
taccacttccctggatctggagcaatatttacaggggacacattgtttagtttgtcatgt
ggaaagctttttgaagggactccacaacagatgtactcttcactccagaaaattatagca
cttccggatgagacaagagtgtattgcggacatgaatatacattgagcaattcaaagttt
gccttgagcatagaaccaggaaataaagacttacaggaatacgctgcaaatgccgctgat
ctccgcaagaggaatacacccacggtgccaacaacaattgggagagagaagcagtgcaat
ccttttctgaggacctcaagtccagagataaagaataccctgtccatcccagaccatttt
gatgatgcacgcgttcttgaagttgttcgacgagcgaaggataacttttaa

DBGET integrated database retrieval system