KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332758
Entry
4332758           CDS       T01015                                 
Name
(RefSeq) valine--tRNA ligase, mitochondrial 1 isoform X1
  KO
K01873  valyl-tRNA synthetase [EC:6.1.1.9]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    4332758
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4332758
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    4332758
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.9  valine---tRNA ligase
     4332758
Amino acid related enzymes [BR:osa01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   4332758
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    4332758
 Prokaryotic type
    4332758
SSDB
Motif
Pfam: tRNA-synt_1 Anticodon_1 tRNA-synt_1g tRNA-synt_1_2 tRNA-synt_1e Val_tRNA-synt_C
Other DBs
NCBI-GeneID: 4332758
NCBI-ProteinID: XP_015632774
LinkDB
Position
3:complement(12422364..12432702)
AA seq 1058 aa
MEKQPEVHGPEKAPEKQLDEKTLERKLRKNQKAKEKEEKRLKAKQKEAAMLQAQPALDVL
KKVEKKHRGKAVEDENPEDFIDQDTPNGQKKLLAPQMANQYCPSTVEKSWYAWWESSGYF
RADSASTKPPFVIVMPPPNVTGALHIGHALTVAIEDAMIRWRRMSGYNALWVPGVDHAGI
ATQVVVEKKLMRERNLTRHDIGPDNFVCEVLKWKERYGGTILNQLHRLGASLDWSREAFT
MDEQRSNAVTEAFVRLHKEGLIYRDNRLVNWDCTLLTSISEIEVDHIDLKEETMLKIPGY
ATPVQFGVLISFAYPLEEGLGEIVVATTRIETMLGDTAIAVHPEDKRYMHLHGRYAVHPF
NGRKLKIICDAEIVDPSFGTGAVKIAPAHDPNDFEVGRRNNLQFINILTDDGKINSNGGA
QFEGMPRFTARICIIEALKAKGLYKGAKNTETSLGICSRTNDIVEPMIKSPQWFVNCNTM
AKVALDAVRSKRIEIIPPQYEQDWYRWLENIRDWCVSRQHWWGHRVPAWYVTLEDDQEKT
LGSDNDRWIVAKSESAASVEAQKSYPGKKFILNQDPDVLDTWFSSALFPLAVLGWPDDTA
DLRSFYPTSVLETGLDILFCWVARMVMMGTQLGGDVPFQKVYLHPIVCDTHGRKMCKSLG
NVIDPLEVINGMTLEGLVKRLEEGNLDPDELNLERKLTDYPDGIAECGTDALRFALISYT
SQSDRINLDIKRVVGYRQWCNKLWNAIRFAMGKLGVHYSPPATVDVSIMPPICKWILSAL
NKATGKTVTSLEAYKFSDATSAIYSWWQYQLCDVFIEAIKPYFFNEPQEFESARVASRDT
LWVCLETGLRLLHPFMPYITEELWQHLPQPKYSCRQDSIMISEYPSLVEEWTNDNLENEM
DIVLDTVNKIRSLKTRTERKERRPAFALCRSQDVTATIQCHQSLIVCLSSVSFLKILTEN
DETPADCAIAVVNKDLSVYLKLQGAINAEAEREKLRKKRDGIQKLHHAVTHMMDASGYRE
KAPQSVQEGDMRKHTALLRELEGISEAEKKLDAKTDNI
NT seq 3177 nt   +upstreamnt  +downstreamnt
atggaaaagcagcccgaggtgcatggtccggagaaggctccggagaagcaacttgatgag
aaaacgttagaacggaaactgaggaaaaatcagaaggctaaagagaaagaagagaaaaga
cttaaagcaaaacaaaaggaggcagctatgcttcaggcacagccagctttagatgtactc
aagaaggttgagaagaaacataggggaaaagctgtggaggatgaaaatcctgaagatttt
attgatcaagacactcctaatgggcagaagaaactgcttgcacctcaaatggccaatcag
tattgcccaagcacggttgagaaatcatggtatgcctggtgggaatcatcaggatatttt
agggcagattctgcaagcacaaagccaccatttgttatagttatgccacctccaaatgtg
actggagctcttcacataggccatgctcttacagtggctatagaggatgcgatgatacga
tggcggaggatgtcaggttataatgctctatgggtccctggagtggaccatgctggcatt
gctacacaggttgtagtagaaaaaaagcttatgcgtgaaaggaatctgacaaggcatgac
atagggcctgacaattttgtttgtgaagttctcaaatggaaagagcggtatggtggtact
atattgaatcaattgcaccgccttggggcctcacttgattggtctcgtgaggcttttaca
atggatgagcaaaggtcaaatgctgtaactgaagcttttgtaaggttacacaaggaaggc
ctgatatatagagataaccgccttgtgaattgggactgcacacttctgacttcaatttct
gagatagaggttgatcatattgatcttaaagaagaaacaatgttaaagatccctggttat
gctactcctgtacaatttggtgtgttgatatcttttgcctatcctcttgaagaagggcta
ggtgagattgttgttgcaacaactcgaattgaaacaatgcttggtgatacagcaatagct
gttcatcctgaggataaaaggtatatgcatctgcatggacggtatgcagtccaccccttc
aatggccgaaaactcaaaataatctgtgatgctgagatagttgatcccagtttcggtact
ggggctgtcaagattgcacctgcacatgacccaaatgactttgaggttggaagacggaat
aaccttcagttcattaatatcttgacagatgatgggaaaataaacagcaatgggggtgca
caatttgaaggaatgccaagattcactgctcgaatttgcattattgaagcactgaaggca
aagggcttgtacaagggtgcaaagaataccgaaacgagtttgggcatttgttcaagaact
aacgacatagtggagcctatgataaaatccccgcagtggtttgttaattgtaacaccatg
gccaaggtagcccttgatgctgtaaggtctaagaggattgagatcattcccccgcagtac
gaacaagactggtatagatggcttgaaaatatacgtgattggtgtgtttcaaggcaacat
tggtggggacaccgtgtacctgcatggtatgtgacactagaagatgaccaggagaaaact
ctaggttctgacaatgaccgctggatagtcgccaaaagtgaaagtgctgcaagcgttgag
gcacagaaaagttatccaggaaagaaattcatcctaaatcaggatcctgatgtgctagac
acatggttttcatctgctctcttccccttagcagtacttggttggccagatgatactgct
gacctccgttctttctaccctacttcagttctagaaactggacttgatattctcttctgt
tgggtagcacggatggtgatgatgggaacacaacttggtggtgatgtgccgtttcagaag
gtttatttgcatcctattgtatgcgacacacatggccgaaaaatgtgcaagtcacttggt
aatgtcattgatcctcttgaggtgataaatggcatgacactcgagggtcttgtaaaacgt
ctggaagaaggtaatctggatccagatgaattaaaccttgaacggaagctgacagattat
cctgatggaattgctgaatgtggtactgatgccctccgctttgcactgatttcttacact
tctcagtctgacaggataaatcttgatatcaagagagtggttggataccgacaatggtgc
aataaattgtggaatgccatccgttttgccatgggcaagcttggtgttcactacagtcca
cctgcaactgtcgacgtgtctatcatgccaccaatctgcaagtggatactctcagcacta
aacaaggctaccggcaaaactgttacctctttagaagcatacaaattctctgatgcaaca
tctgctatatactcttggtggcaataccagctatgtgatgtatttatagaagctataaaa
ccttacttcttcaacgaacctcaagagtttgaatctgcaagagtcgcctccagagatact
ctatgggtttgcctggagactggtttgcgcttgctccacccattcatgccttacataaca
gaagagctatggcagcatcttccacaacccaaatattcttgtaggcaagattcaattatg
atttcggaatatccatctctcgttgaggaatggactaatgacaatcttgaaaatgaaatg
gacattgtcttagacaccgtgaacaaaataaggtctttgaagacacgaacagaaagaaaa
gaaagacgtcctgcttttgcactctgccgaagccaagatgtcactgccactattcaatgc
catcaatctctaattgtgtgtctttcttccgtatcatttcttaagatcctgacagagaat
gacgaaactccagctgattgtgcaatcgctgttgttaacaaagatttgtcggtgtacctt
aagcttcaaggagccataaatgcagaggctgagcgtgaaaagctaaggaagaagagagat
ggaatccaaaagctacaccatgctgtgacacacatgatggatgcttctggttatcgcgag
aaggcacctcaaagtgtccaggaaggggatatgagaaagcacactgctttgttgcgggaa
ctggagggcataagtgaagctgagaagaaactagatgccaaaaccgataatatttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333799
Entry
4333799           CDS       T01015                                 
Name
(RefSeq) valine--tRNA ligase, mitochondrial 1
  KO
K01873  valyl-tRNA synthetase [EC:6.1.1.9]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    4333799
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4333799
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    4333799
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.9  valine---tRNA ligase
     4333799
Amino acid related enzymes [BR:osa01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   4333799
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    4333799
 Prokaryotic type
    4333799
SSDB
Motif
Pfam: tRNA-synt_1 Anticodon_1 tRNA-synt_1g tRNA-synt_1_2 tRNA-synt_1e Val_tRNA-synt_C CCDC28
Other DBs
NCBI-GeneID: 4333799
NCBI-ProteinID: XP_015630957
UniProt: Q851K9 A0A0N7KHV5
LinkDB
Position
3:27826856..27835245
AA seq 1054 aa
MSSVTPAADAQPLDEKELERKLKKDQKAKEKEEKRLKAKAKEAARLQAQAASDGPKKSEK
KQRKKAVEDENPEDFIDPDTPHGQKKFLASQMAKQYSPTAVEKSWYSWWESSGYFGADAA
SSKPPFVIVLPPPNVTGALHIGHALTVAIEDSMIRWRRMSGYNTLWVPGVDHAGIATQVV
VEKKLMRERNLTRHDIGREEFVSEVLKWKDEYGGTILNQLRRLGASLDWSRECFTMDKPR
SKAVTEAFVRLYKQGLIYRDYRLVNWDCTLRTAISDVEVDYLEIKEETMLKVPGYNTTVQ
FGVLISFAYPLEEGLGEIIVATTRIETMLGDTAIAVHPEDGRYKHLHGRYAIHPFNGRKL
KIICDAELVDPTFGTGAVKITPAHDPNDFEVGKRHNLEFINIFTDDGKINNNGGAQFVGI
PRFTARVAVIEALKAKGLYKETKKNEMSLGVCSRTNDVVEPMIKPQWFVNCNTMAQAGID
AVRSKRIEIIPQQYEQDWYRWLANIRDWCISRQLWWGHRVPAWYVILEDDQEKILGSANG
RWIVARNESEANLEAQQKYPGKKFELHQDPDVLDTWFSSGLFPLTVLGWPDDTADLKAFY
PGSVLETGHDIIFFWVARMVMMGMQLGGDVPFEKVYLHPMIRDAHGRKMSKSLGNVIDPV
DVINGISLDGLLKRLKEGNLDPNELNIATEGKKKDFPDGIAECGTDALRFALVSYTSQSD
KINLDIKRVVGYRQWCNKLWNAIRFAMGKLGNHYTPPATISVTTMPPICKWILSVLNKAI
GKTVTSLEAYKFSDATSAIYSWWQYQLCDVFIEAIKPYFFNDSQEFESARAASRDALWVC
LDTGLRLLHPFMPYVTEELWQRLPQPKDSCRKDSIMVSEYPSVVKEWTDDKLENEIDIAL
DTINKLRSLKPPSDTNERRPAFALCRGQEITATIQCYQSLVVSLSSTSSLKILTENDETP
PDCATAVVNKDLSVYLQLQGALNAEVELEKLRKKREEIQKLQHALSQKMEASGYKEKAPQ
NVQEEDMRKLTSFFEQLEIISEAEKKLDAKTGNN
NT seq 3165 nt   +upstreamnt  +downstreamnt
atgtccagcgttacccctgctgccgacgcgcagccactcgatgagaaagagctggagcgg
aagctgaagaaagatcagaaggcaaaagagaaagaggaaaaaaggcttaaggcgaaggca
aaggaggcggctaggctccaggcacaagcagcttcagatggacctaagaaaagcgagaag
aagcaaaggaagaaagctgtggaggatgagaatcctgaggatttcattgatccagacact
cctcatgggcagaagaaatttcttgcatctcaaatggccaagcagtatagcccaactgct
gttgagaaatcatggtattcctggtgggaatcatcaggatattttggggcagatgctgca
agctcaaagccaccatttgttatagttttgccacctccaaatgtcactggagcgcttcat
ataggccatgcacttacggtggctatagaggattccatgatacgctggcggaggatgtca
ggttataacactctgtgggttccaggagttgaccatgcaggaatcgctactcaggttgta
gtggagaagaagcttatgcgtgaaaggaatttgacaaggcatgacatagggcgtgaagaa
tttgtatctgaagttctcaaatggaaagatgaatacgggggtaccatattgaatcaattg
cgtaggcttggggcctcacttgattggtcccgcgagtgttttacaatggataaaccaaga
tcaaaggctgtaactgaagcttttgtcaggttgtacaaacaaggcctgatatatagggat
tatcgcctcgtgaattgggattgcacccttcgaacagcaatttctgacgtagaggttgat
tatctagagattaaagaggaaactatgttaaaggttcctggttataatacaactgtacaa
ttcggtgtgttgatctcttttgcatatccacttgaggaaggattgggtgagattattgtc
gcaacaacaagaatcgaaacaatgcttggggatacagccattgctgttcaccctgaggat
ggcagatacaagcatctgcatggtaggtatgcaatccatcccttcaatggccgaaagctc
aaaataatctgtgatgctgagttagtggatcccactttcggtactggggctgtcaagatt
acacctgcccatgatccaaatgattttgaggttggaaagcgacacaaccttgagttcatc
aatatcttcacagatgatggaaaaataaacaacaatggaggtgcacaatttgtaggaatt
ccaagatttactgctcgagttgctgttattgaggcactgaaggcaaagggcttgtacaag
gagacaaagaagaacgaaatgagtttgggtgtttgttcaagaactaatgatgtggtggag
cctatgataaaaccccaatggtttgttaattgcaataccatggcacaagcaggtattgat
gctgtaaggtccaaaagaattgagattattccacaacagtatgagcaagactggtataga
tggcttgcaaatatacgtgattggtgtatttcgaggcagctttggtggggacatcgcgtt
cctgcttggtatgttatactagaagatgatcaagagaaaattctgggttctgctaatggc
cgttggattgttgctagaaacgaaagtgaagcaaacctggaggcacagcaaaagtatcct
gggaagaaattcgagttacatcaagatcctgatgtgttggatacatggttttcatctggt
ctcttcccattaaccgtacttggttggccagatgatacagctgaccttaaagctttctac
cctggttcggtgctagaaactggacatgacattatcttcttttgggtagcacggatggtg
atgatggggatgcaacttggtggcgatgtgccatttgagaaggtttatttgcaccctatg
atacgtgatgctcatggacgcaaaatgtccaagtcgcttggtaatgtcattgatcccgtt
gatgtgataaatggcatttcactggatggtctcctcaaacgtttgaaagaaggcaatcta
gatccaaatgaattgaacattgcaacagaagggaagaagaaggattttcctgatggcatt
gctgaatgtggtaccgatgctctccgttttgcactggtttcttacacttcgcagtctgac
aagataaacctggatatcaaacgagttgttggatatcgacagtggtgcaataaattatgg
aatgccattcgttttgcaatgggcaagcttggcaatcattacactccccctgcaactatt
tctgtaactacaatgccacccatatgcaaatggatattgtcagtacttaataaagctatt
ggcaaaactgtcacctcgttagaagcatacaaattttctgatgctacatctgctatatac
tcgtggtggcagtaccaactatgtgatgtgttcatagaagctataaagccttacttcttc
aatgactctcaagagtttgaatcagcaagagctgcctctagagatgccttatgggtttgc
ttagacactggtttgcgcttgctccacccattcatgccttatgttacagaagagctctgg
cagcgtcttcctcagcctaaagattcttgtcggaaagattccattatggtatcagagtac
ccatctgttgttaaggaatggacggatgataaacttgaaaatgagatagatattgcctta
gatactatcaacaaactaagatctctgaagccaccatctgatacaaatgagagacgacct
gcttttgcactttgccgaggccaagagattactgccaccattcagtgttatcagtctcta
gttgtgtctctttcttccacatcatctctaaagatcctgacagagaatgatgaaacgcca
cctgactgtgcaacagctgttgtaaacaaagatttgtctgtataccttcaactccaagga
gctctcaatgcagaagttgagcttgaaaagctgaggaaaaagagagaagaaattcaaaag
ctccaacacgcactgtcacagaaaatggaagcttctggttacaaagagaaggctccacag
aatgtccaggaggaggacatgagaaaactcactagtttttttgaacagctagagattatc
agtgaagctgaaaagaagctagatgcaaaaactggcaataattga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342467
Entry
4342467           CDS       T01015                                 
Name
(RefSeq) valine--tRNA ligase, chloroplastic/mitochondrial 2
  KO
K01873  valyl-tRNA synthetase [EC:6.1.1.9]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    4342467
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4342467
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    4342467
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.9  valine---tRNA ligase
     4342467
Amino acid related enzymes [BR:osa01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   4342467
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    4342467
 Prokaryotic type
    4342467
SSDB
Motif
Pfam: tRNA-synt_1 Anticodon_1 tRNA-synt_1g Val_tRNA-synt_C tRNA-synt_1_2 tRNA-synt_1e
Other DBs
NCBI-GeneID: 4342467
NCBI-ProteinID: XP_015647924
LinkDB
Position
7:3388105..3400194
AA seq 958 aa
MALAGASSSACLRRLNPLLFSAHRRPAWTPRRAARRFCAAAVASERDVFTSPEVAKSFDF
TNEERIYKWWESQGFFKPNFDRGGDPFVIPMPPPNVTGSLHMGHAMFVTLEDIMVRYFRM
KGRPALWLPGTDHAGIATQLVVEKMLAAEGIKRTDLTREEFTKRVWEWKEKYGSTITNQI
KRLGASCDWSRERFTLDEQLSRAVIEAFVRLHEKGLIYQGSYLVNWSPNLQTAVSDLEVE
YSEEPGNLYFIKYRVAGGSRDDFMTIATTRPETLFGDVAIAVNPEDERYAKYVGKLAIVP
LTFGRHVPIIADRYVDPEFGTGVLKISPGHDHNDYHIARKLGLPILNVMNKDGTLNDVAG
LYSGMDRFEAREKLWSDLVETNLAVKKEPYTLRVPRSQRGGEVIEPLISKQWFVTMDPLA
EKALHAVEKGQLTILPERFEKIYNHWLTNIKDWCISRQLWWGHRIPVWYIVGKKCEEDYI
VARSAEEALAKAQEKYGKSVEIYQDPDVLDTWFSSALWPFSTLGWPDLSSEDFKHFYPAT
VLETGHDILFFWVARMVMMGIEFTGTVPFSYVYLHGLIRDSEGRKMSKTLGNVIDPLDTI
KEYGTDALRFTLSMGTAGQDLNLSTERLTSNKAFTNKLWNAGKFLLQNLPDRSDATAWDV
LLANKFDTEASLQKLPLPESWVVTGLHELIDRVSTSYDKFFFGDAAREIYDFFWGDFADW
YIEASKTRLYHSGDDSASSMAQSVLLYVFENILKLLHPFMPFVTEELWQALPYRKQAIIV
AHWPATDLPKNSLSIKRFQNLQSLIRGIRNVRAEYSVEPAKRISSSVVAAADVLDYISKE
KQVLALLSKLDMQSIHFSELPPGDANQSVHIVADEGLEAYLPLADMVDVSEEVKRLSKRL
SKMQSEYDSLLARLNSGSFVEKAPEEIVRGVREKASEAEEKISLTKNRLAFLQSTVSS
NT seq 2877 nt   +upstreamnt  +downstreamnt
atggcgctcgcgggcgcctcctcgtcggcctgcctccgccgcctcaacccgctcctcttc
tccgcccaccgccgccccgcgtggaccccgcgccgcgccgcccgcaggttctgcgcagct
gcagttgcctcggagagagatgtgttcacctccccggaggtcgccaagtcgttcgacttc
accaatgaggagcggatttataagtggtgggagtctcaaggattctttaagcctaacttt
gatcgtggaggagatccatttgtcatcccaatgccaccaccgaatgttaccggatcgctg
catatgggccatgctatgtttgtcacccttgaggatataatggtaaggtatttccgtatg
aaaggaaggcctgcactttggttgcctggtactgaccatgcagggattgccactcagttg
gttgtggaaaagatgttagctgctgaaggaatcaaaagaacagatctgacccgagaggag
ttcactaaaagagtttgggagtggaaagaaaagtacgggagcactatcactaatcagatt
aagcgattgggtgcatcttgtgattggagtcgtgagcgtttcactcttgatgaacaatta
agtcgtgcagttattgaagcatttgttaggcttcatgaaaaagggcttatatatcaagga
tcttacttggtcaactggtctccaaacctacagactgcagtatctgatttagaagtggaa
tactctgaagaacctggtaatttgtacttcatcaagtaccgtgtggcaggtggatcaagg
gatgattttatgactattgcaacaacacggcctgagactctctttggcgatgttgcaatt
gctgtaaacccagaggatgaacgttatgcaaaatatgtgggcaaattggctattgttccc
ttgacatttgggagacatgttcctattattgctgaccggtatgttgatccagaatttgga
acaggggtgctgaagattagccctggacatgatcataacgattatcatattgcacgaaaa
cttgggttgccaattctcaatgttatgaacaaagatggtacactaaatgatgttgctgga
ttatacagtggcatggatcgttttgaggcacgggagaagttgtggtctgaccttgttgag
actaacttggcagtaaagaaggaaccctatacacttcgagttcctagatctcaacggggt
ggtgaagtaatagagccattgattagtaaacagtggtttgtcactatggatccattagct
gaaaaggcccttcatgctgttgaaaaagggcaactaactattcttccagagagatttgaa
aagatatataatcattggttgacaaacataaaggattggtgtattagtaggcaactgtgg
tggggtcatcggatccctgtttggtacatcgttggaaagaaatgtgaggaagactatatt
gttgctagaagtgcagaggaggcacttgcaaaggctcaggaaaaatatggaaaatcagtt
gaaatatatcaagatcctgatgttcttgacacttggttctcaagtgctctgtggcctttc
agtacacttggttggccagacctatccagtgaggattttaagcacttttatcctgcaact
gttcttgagactggccatgacattttgttcttctgggttgcacgaatggtcatgatggga
attgagtttacaggaactgtgccattttcttatgtttatcttcatggtctcatccgggac
tctgagggacgaaaaatgtctaagacactggggaatgtcattgaccctctagataccatc
aaagagtacgggacagatgcattgagatttacactttccatgggtaccgcaggccaggac
cttaatctctctacagaaagattgacatcaaacaaggctttcaccaacaaactctggaat
gcaggcaaatttttgttgcagaatttgcctgatagaagtgatgccactgcatgggatgtc
ttgttagcaaataagtttgatacagaagcgtcacttcagaaactaccactgccagaatcc
tgggtggtgacaggattacacgaactcatcgatagggtcagcacaagctacgacaaattt
ttctttggcgatgcagctagagaaatctacgatttcttttggggggactttgctgattgg
tatattgaagccagcaagacacgtctttaccactctggtgatgattcagcttcttctatg
gcacaaagtgttctgttgtatgtgtttgaaaacatactgaagctattgcaccccttcatg
ccctttgtcactgaagagttatggcaggcattgccatacagaaaacaagcaattattgtt
gcccactggcctgcgactgatctccctaagaattctctctcgatcaagagatttcagaat
ttgcaatcgttgataagaggtatcagaaatgttcgagcagagtattctgttgagccagcc
aagcgaatatcttcatcagttgttgctgccgcagatgtcctagattacatatcgaaggag
aagcaggtcctggctttactttcaaagcttgacatgcagagtatacattttagcgagttg
ccgccaggtgatgcaaatcagtcggtccacattgttgctgatgagggtctggaggcctat
ctacccctggctgacatggtggatgtttctgaggaagttaagcggctgtcaaagcgcctc
tctaagatgcagtcggaatatgattctttgctggcccgtctcaattcaggaagttttgta
gagaaggccccagaagaaattgttcgtggagttcgtgagaaagcatcagaagcagaagag
aagatctccctcaccaagaatcggctcgctttcctgcagtcaacagtatcaagttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9267455
Entry
9267455           CDS       T01015                                 
Name
(RefSeq) valine--tRNA ligase, mitochondrial 1
  KO
K01873  valyl-tRNA synthetase [EC:6.1.1.9]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    9267455
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    9267455
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    9267455
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.9  valine---tRNA ligase
     9267455
Amino acid related enzymes [BR:osa01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   9267455
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    9267455
 Prokaryotic type
    9267455
SSDB
Motif
Pfam: tRNA-synt_1 Anticodon_1 tRNA-synt_1g tRNA-synt_1_2 Val_tRNA-synt_C
Other DBs
NCBI-GeneID: 9267455
NCBI-ProteinID: XP_015614977
LinkDB
Position
10:19355915..19363359
AA seq 1048 aa
MTITGAMEKPLDEKELERKLKKDQKAREKEEKRLKAKQKEAIRLQAQAASDETKKSDKKQ
KKKGTPDENPEDFVDPDTPAGQKKLLASQMAKQYNPAAVEKSWYSWWESSQYFVADATSS
KPPFVIILPPPNVTGVLHIGHAITVAIEDAMIRWRRMSGYNALWVPGMDHAGIATQVVVE
KRLMRDRNLSRHDLGRDKFLLEVLQWKDQHGGTILKQLRTLGASLDWSRECFTMDEKRSK
AVTEAFIRLHKEGLIYRDNRIVNWDCSLRTAISDIEVDYCELTEETLLEVPGCSTLVQFG
VIINFAYPLEEGLGEIIVATTRIETMLGDTAIAVHPQDERYKRLHGKHALHPFNGRKLKI
ICDSKLVDPSFGTGAVKITPAHDLDDFNTGKRHKLEFINIFTDDGNINENGGPQFEGMPR
FTARAAIIDALKAKGLYRGTENNKMRLGRCSRTKDIVEPMMKPQWFVDCSTMAKAALDAV
KTKRIEIIPIQYEQDWYRWLENIRDWCISRQLWWGHRIPAWYVTLEDDEEKDIGSYIDHW
IIARNESDAILEAKQRYPGKNYKLDQDPDVLDTWFSSGLFPLSVLGWPDSTADLSSFYPT
SVLETGLDILFFWVARMVMMGMLLGGDVPFQKVYLHPIIRDPHGRKMAKCLGNVIDPIDV
INGISLEDLGKKLEHGNLDPSELEKAKEGQKKDFPNGIPECGTDALRFALISYTSQSDKI
NLDIKRVHGYRQWCNKLWNAVRFAMNKLGDQYTPPAAIALCSMPPLCKWILSALNKAVGK
TVSSMEACKFSEATSSMYSWWQYQLCDVFIEAVKPYFNQSQELESERGACRDTLWICLDT
GLRLLHPFMPYITEELWQRLPQPKEACRKDSIMISEYPSVVQEWTNDQVENEMETVLDSV
NKLRSLRPHTDIHERRPAFMLCRGVDIAAIIQCYQAQISTLASVSSLKILTEDDPTPPNC
ATNIVNKDLSVYLQLRGALNTEAEREKLRKKRDEIQKQHDTLSQKMNASGYREKAPQSKQ
DEDMKKIAALLEELEIIREAESELESNN
NT seq 3147 nt   +upstreamnt  +downstreamnt
atgactatcaccggcgccatggagaagccactcgatgagaaggagctggaaaggaagctg
aagaaagatcagaaggcaagagagaaggaggagaagaggctcaaggcgaagcaaaaggag
gcgattaggctacaggcacaagcagcatctgatgaaacaaagaagagcgacaagaaacaa
aagaagaaaggcacaccggatgagaatcctgaggatttcgtcgacccggatactcctgct
gggcagaagaagctgcttgcttctcaaatggccaaacaatataatccagctgctgttgag
aaatcatggtattcttggtgggaatcatctcaatattttgtagcagatgcgacgagttct
aaaccaccatttgtaataatcttgccacctcctaatgtaactggggtccttcatataggc
catgcgattacagtagcaattgaggatgctatgattcgctggcggaggatgtcgggctat
aacgctttgtgggttcctggaatggaccatgctggcatagctacacaggtggttgtggaa
aaaaggcttatgcgtgacagaaacctgtcaagacatgatctggggcgtgataaatttcta
ttggaggtcctccaatggaaagatcagcatggtggtaccatattgaaacaattacgtaca
cttggagcctcacttgattggtcacgcgagtgttttacaatggatgagaagagatcaaaa
gctgtaacagaagcttttatcagactgcacaaagaaggcctaatatatagggataatcgc
attgtgaactgggattgctcacttcgtactgcaatttcagatattgaggttgactattgt
gaacttacagaagagactttgttagaggtccctggatgtagcactcttgtccagttcggt
gttataataaattttgcttatcctctagaggaagggttgggtgaaattatcgttgcaaca
acaagaatagaaacaatgcttggtgatactgcaatagctgttcatcctcaggatgaaaga
tacaagcgtttgcatggaaaacatgctctccatccctttaatggccggaaactcaaaata
atttgtgactccaagttagtggatcccagttttggtacaggagctgtcaagatcacgcca
gctcatgatcttgatgacttcaacactggcaaacgacataaacttgagttcattaatatt
ttcacagatgatgggaacataaatgaaaacggaggtccacaatttgaaggaatgccacgt
ttcactgctcgggctgctattattgatgcactaaaggcaaagggtctatacagaggcaca
gaaaataataagatgcgcttgggccgttgttcaagaactaaagatattgtggagccaatg
atgaagccccaatggtttgtcgattgtagtactatggcaaaggcagctcttgatgctgtg
aaaactaaaaggatcgagatcattccaatacaatacgagcaagactggtatagatggctt
gaaaacatacgtgattggtgtatttcaagacagctttggtggggacaccgtataccagct
tggtatgtaacgctagaagatgatgaggagaaagacataggttcttacattgatcactgg
ataattgcaagaaatgaaagtgatgcaatcctggaggcaaagcagaggtatccagggaaa
aattataagttagaccaagatcctgatgtgctggatacatggttttcatctggtcttttc
ccattgtctgtgcttggttggccagacagcacagctgatcttagttcattctaccctact
tctgtacttgaaactggactggatatcctcttcttttgggtagcacggatggtgatgatg
ggaatgctacttggtggtgatgtgccatttcagaaggtttacttgcatccaattatccgc
gatccacatggccgcaaaatggcgaagtgcctaggaaatgtcattgatcccattgatgta
ataaatggtatatcacttgaagatctcgggaaaaagttggaacatggcaatcttgatcca
agtgagttagaaaaggcgaaagaaggtcagaagaaggatttccctaatggcattccagag
tgtggtactgatgcccttcgttttgccctgatctcctacacttctcagtctgacaaaata
aatctggatatcaagagagtgcacggatacagacaatggtgcaataaactgtggaatgcc
gtccgttttgccatgaacaagcttggagatcaatacactccaccagcggctattgcgttg
tgttctatgccacctctctgcaaatggatactctcagcacttaacaaggctgttggcaag
actgtttcatcgatggaagcatgtaaattctccgaggccacatcgtctatgtactcttgg
tggcagtaccaactttgcgatgtatttatagaagccgtaaaaccttacttcaatcaatct
caagagttggaatctgaaagaggtgcttgtcgtgatacattatggatatgtctggatacc
ggtttgcggttgctccacccgttcatgccttacataacggaggagctttggcagcgcctt
cctcagcctaaagaggcttgtaggaaagattccataatgatatctgagtacccctcagtt
gttcaggaatggacaaatgatcaagttgaaaatgaaatggagactgtgttggattctgtg
aacaagctaagatctcttcggccacatacagatatacatgaaagacggcctgcttttatg
ctctgccgtggggtagacattgctgccattattcagtgctaccaggcgcagatttcaact
cttgcttctgtttcatctcttaagatactgacagaggatgatccaactccacccaactgt
gccacaaatattgtcaacaaagatctatccgtatacctccagctacgaggagctctaaac
actgaagctgagcgtgagaagctaaggaaaaagcgagatgagattcaaaagcaacacgac
accttgtcgcagaaaatgaatgcctcaggctatcgcgagaaggctcctcagagcaagcaa
gatgaggacatgaaaaagattgctgcattactggaggaacttgagatcattagagaagcc
gaaagtgaactagaatcaaacaactga

DBGET integrated database retrieval system