KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332773
Entry
4332773           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L19-1
  KO
K02885  large subunit ribosomal protein L19e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4332773
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4332773
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4332773
  Archaea
    4332773
SSDB
Motif
Pfam: Ribosomal_L19e CowN
Other DBs
NCBI-GeneID: 4332773
NCBI-ProteinID: XP_015632604
UniProt: A0A8J8Y344 Q10LR6
LinkDB
Position
3:complement(12542336..12544701)
AA seq 208 aa
MVSLKLQKRLAASVLKCGKGKVWLDPNEVNEISMANSRQNIRKLVKDGFIIKKPQKIHSR
SRARRAHEAKQKGRHSGYGKRRGTREARLPTKILWMRRMRVLRRLLRKYREAKKIDKHMY
HDMYMKVKGNMFKNKRVLMESIHKSKAEKAREKTLSDQFEAKRAKSKASRERKIARREER
LAQGPREPAAPAAAAPAQTAAAPKKAKK
NT seq 627 nt   +upstreamnt  +downstreamnt
atggtttccctcaagctgcagaagcggctcgccgccagcgtgctcaagtgcggcaagggc
aaggtctggctcgaccccaatgaggtcaacgagatctccatggccaactcccgtcagaac
atccgtaagttggtcaaggatggattcatcatcaagaagccccagaagattcactccagg
tcccgagcacggagagcccatgaggctaagcagaagggacgtcactctggctatggtaag
cgtaggggtacaagggaggctaggctccccaccaagatcctgtggatgaggaggatgcgt
gtgctcaggcgtttgctgcgcaagtatcgtgaggccaagaagattgacaagcacatgtat
catgacatgtacatgaaggtcaagggtaacatgttcaagaacaagcgtgttcttatggaa
agtatccacaagtctaaggctgagaaggcaagagagaagacactctctgaccagtttgag
gctaagcgtgccaagagcaaggcaagccgtgagaggaagattgccaggagggaggagagg
ttggctcagggcccaagagagccagcagctcctgcagcggcagctcctgctcaaactgca
gcggcacctaagaaggcaaagaagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333317
Entry
4333317           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L19-1
  KO
K02885  large subunit ribosomal protein L19e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4333317
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4333317
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4333317
  Archaea
    4333317
SSDB
Motif
Pfam: Ribosomal_L19e CowN
Other DBs
NCBI-GeneID: 4333317
NCBI-ProteinID: XP_015632739
UniProt: Q84NX8 A3AJV0
LinkDB
Position
3:complement(21238649..21240885)
AA seq 206 aa
MVSLKLQKRLASSVLKCGKGKVWLDPNEVNEISMANSRQNIRKLVKDGFIIKKPQKIHSR
SRARRAHEAKQKGRHSGYGKRRGTREARLPTKILWMRRMRVLRRLLRKYREAKKIDKHMY
HDMYMKVKGNMFKNKRVLMESIHKSKAEKAREKTLSDQFEAKRAKSKASRERKIARRDER
LAQGPREPAAPAVPAQTAAAPKKYKK
NT seq 621 nt   +upstreamnt  +downstreamnt
atggtttccctcaagctgcagaagcggctcgcctccagcgtgctcaaatgcggcaagggc
aaggtctggctcgaccccaatgaggtcaacgagatctccatggccaactcccgtcagaac
atccgtaagttggtcaaggatgggttcattatcaagaagccccagaagattcactccagg
tcccgtgcacggagagcccatgaggccaagcagaagggacgtcactctggctatggtaag
cgtaggggtaccagggaggctaggctccccaccaagatcctgtggatgaggaggatgcgt
gtgctcaggcgtttgctgcgcaagtatcgtgaggccaagaagattgacaagcacatgtat
catgacatgtacatgaaggtcaagggtaacatgttcaagaacaagcgtgttctcatggaa
agtatccacaagtctaaggctgagaaggcaagagagaagacactctctgaccagtttgag
gctaagcgtgccaagagcaaggccagtcgtgagaggaagattgccaggcgtgacgagagg
ttggctcagggcccaagagagccagctgctccagcagtgcctgctcaaactgcggcggca
ccaaagaagtataagaagtga

DBGET integrated database retrieval system