KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332774
Entry
4332774           CDS       T01015                                 
Name
(RefSeq) fumarate hydratase 1, mitochondrial
  KO
K01679  fumarate hydratase, class II [EC:4.2.1.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00020  Citrate cycle (TCA cycle)
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
osa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    4332774
   00620 Pyruvate metabolism
    4332774
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.2  fumarate hydratase
     4332774
SSDB
Motif
Pfam: Lyase_1 FumaraseC_C
Other DBs
NCBI-GeneID: 4332774
NCBI-ProteinID: XP_015633139
UniProt: Q10LR5
LinkDB
Position
3:complement(12545987..12552200)
AA seq 502 aa
MAMVLRRLAGASAGGAPSPAAAAAAAALLLRPALARPISTGFREERDTFGPIRVPNDKLW
GAQTQRSLQNFDIGGERERMPVPIIRAFGVLKKCAAKVNMEYGLDPTIGKAIMQAAQEVA
EGQLDDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKFVHPNDHVNRSQSSND
TFPTVMHIAAATEINSRFVPSLQQLHKSLDSKSVEFQDIIKIGRTHTQDATPLTLGQEFS
GYATQVKYGIDRIVCTLPRMYQLAQGGTAVGTGLNTKKGFDVKIAAAVAEETELPFVTAE
NKFEALAAHDAFVESSGAVNTISASLMKIANDIRLLGSGPRCGLGELILPENEPGSSIMP
GKVNPTQCEALTMVCAQVMGNHVGVTVGGSNGHFELNVFKPMIAAGLLRSLRLLGDASVS
FEKNCVRGIQANHKRISQLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEGSTLKEAALDL
GVLTESEFHELVVPEKMIGPSD
NT seq 1509 nt   +upstreamnt  +downstreamnt
atggcgatggtcctgcggcgcctcgcgggcgcgtccgccggtggcgccccgtcgccggcg
gcggcagcggccgcggccgcgctgctgctccgcccggcgctggctcgcccgatctccacc
ggcttccgcgaggagcgcgacaccttcggccccatccgagtccccaacgacaagctgtgg
ggcgcgcagacgcagaggtcgctgcagaacttcgacatcggcggcgagcgcgagcggatg
ccggtgcccatcatccgcgcctttggggtgctcaaaaagtgcgccgctaaggtgaatatg
gagtatggccttgatccaacaatcgggaaggcaataatgcaggctgctcaggaggttgct
gaaggacagttagatgaccactttccacttgttatctggcaaactgggagtggcacacaa
agcaacatgaacgccaatgaggttattgcaaatagggccgctgagattcttggacataag
cgtggcgagaagtttgtacaccctaatgatcatgtgaacagatcacagtcctcaaatgat
acatttcccactgtcatgcacatagcagcagccacagagatcaattcaaggtttgtccca
agcttgcaacagttgcataagtcacttgattcaaagtctgttgaatttcaagacataatt
aaaattgggcgtacacatacccaagatgccaccccattgacccttggccaagagttcagc
ggttacgccacacaagtgaaatatggaattgatagaattgtttgtaccttaccacggatg
tatcagcttgctcaaggtggaactgcagttggaacgggcttgaacactaagaaaggattt
gatgtcaaaattgctgctgcagtagctgaggaaacggaactacctttcgtgacagctgag
aacaagttcgaagctttggcagcgcatgatgcttttgttgagagcagtggtgctgtaaac
acaatttctgcatctcttatgaagatagcaaatgacatacgcttgttaggaagcggcccc
cgatgtggacttggtgaacttatcctacctgaaaatgagcctgggagcagcattatgcct
ggaaaagttaaccctacccagtgtgaggccttgaccatggtttgtgctcaggttatgggt
aatcatgttggtgtcacagtaggtggttcgaatggacattttgagttgaatgtctttaag
ccaatgattgcagctggattacttagatcactgagattgctaggggatgcctctgtgtcc
tttgagaaaaactgtgtcaggggaattcaagcaaaccataagagaatttcacaattattg
cacgagtctttgatgttggtgacatctttgaaccctaaaattggctatgacaatgctgca
gctgttgctaagaaagcacacaaagaaggaagcacattgaaggaagctgctctagacctc
ggagtattgacagaatcagaattccatgagcttgttgttccagagaaaatgattggtcct
tctgattga

DBGET integrated database retrieval system