KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332781
Entry
4332781           CDS       T01015                                 
Name
(RefSeq) protein pleiotropic regulatory locus 1
  KO
K12862  pleiotropic regulator 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4332781
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4332781
   03400 DNA repair and recombination proteins [BR:osa03400]
    4332781
Spliceosome [BR:osa03041]
 Complex B
  Other components
   Prp19 complex
    4332781
 Complex C
   Prp19-CDC5 complex
    4332781
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   PSO4 complex
    4332781
SSDB
Motif
Pfam: WD40 NBCH_WD40 ANAPC4_WD40 Nucleoporin_N
Other DBs
NCBI-GeneID: 4332781
NCBI-ProteinID: XP_015631891
UniProt: Q10LQ8 A0A5S6RA15
LinkDB
Position
3:12599472..12605509
AA seq 472 aa
MATAEPVEPQSLKKLSLKSLKRSHDLFAPTHSLLFTPDPESKQVRVGCKVNAEYSAVKNL
PTDQGRGQVKSAAAPSTALALPGTQDVKDADNKGSSTAIVPAPHMLPKAPDSTIPGKNTT
ITIPGSSDRFSTSALMERIPSRWPRPVWHAPWKNYRVISGHLGWVRSIAFDPSNEWFCTG
SADRTIKIWDLASGTLKLTLTGHIEQIRGLAVSQRHTYLFSAGDDKQVKCWDLEQNKVIR
SYHGHLSGVYCLALHPTIDILLTGGRDSVCRVWDIRTKAHVSALTGHDNTVCSVFARPTD
PQVVTGSHDSTIKFWDLVAGRTMCTLTHHKKSVRAMALHPKEKSFASASADNIKKFSLPK
GEFLHNMLSQQKTIINSMAVNEDGVLATGGDNGSLWFWDWKSGHNFQQDQTIVQPGSLES
EACIYALSYDVSGSRLVTCEADKTIKMWKEDLSATPETHPINFKPPKDIRRY
NT seq 1419 nt   +upstreamnt  +downstreamnt
atggcgacggcggagccggtggagccgcagtcgctgaagaagctgagcctcaagtcgctc
aagcgctcgcacgacctcttcgcgcccacccactccctcctcttcactcccgatccggag
agtaagcaggttcgtgtcggctgcaaggtgaatgcagagtacagcgcggtgaagaaccta
ccaacagatcagggccgaggacaggtcaagagtgctgcggcaccttcaactgcattggcg
cttccaggaacacaagatgtcaaagatgctgataacaaaggcagcagtactgctattgtt
cctgcaccacatatgctccccaaagcaccggattcaacgataccaggcaagaatacaact
ataacaattcctggttcatctgacagattctctacatctgcactgatggaaaggatacca
agtagatggccacggcctgtctggcatgctccttggaagaattatagggtgatcagtggt
cacttgggatgggtgcggtcaattgcatttgatccaagtaacgaatggttctgtacgggt
tctgccgacaggacgattaagatctgggaccttgcatcaggaacattgaagcttacattg
actggccatattgaacaaattcgtgggcttgctgtgagccaacggcacacatatttattt
tctgctggtgatgacaaacaagtaaagtgttgggatcttgaacaaaacaaggttattagg
tcttatcatggccatttgagtggggtgtactgccttgctctacatccaacaatcgatatc
ttgctgactggtggtcgcgattcagtttgtagggtctgggacatccgaacgaaagctcat
gtttctgctttaactggtcatgataacaccgtatgctcagtgtttgctcgtcctacggat
ccacaagttgtcacgggctcacatgattcaactatcaagttctgggaccttgtagctgga
aggactatgtgtactcttacacatcataagaaatcagttcgggctatggcgctgcatcca
aaagagaaatcgtttgcatctgcatcagcagacaatataaagaagtttagcctgcccaaa
ggcgaatttctacacaatatgctgtcccagcagaaaaccatcataaactcaatggctgta
aatgaagatggtgtcttggcaactggaggggataatgggagtctctggttttgggattgg
aagagtggccataactttcaacaagatcagactatagtacaacctggatcattggagagt
gaggcatgcatatatgccctttcatacgatgttagtggatcacggctggtgacatgtgaa
gctgacaagacaataaaaatgtggaaggaagatttgtcagccactccagagacccatcct
atcaatttcaagcctccaaaggacatcagaagatactga

DBGET integrated database retrieval system