KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332791
Entry
4332791           CDS       T01015                                 
Name
(RefSeq) putative GTP diphosphokinase RSH1, chloroplastic
  KO
K00951  GTP pyrophosphokinase [EC:2.7.6.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4332791
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.5  GTP diphosphokinase
     4332791
SSDB
Motif
Pfam: HD_4 RelA_SpoT TGS HD ACT_4 OST_P2
Other DBs
NCBI-GeneID: 4332791
NCBI-ProteinID: XP_015632055
UniProt: Q9AYT5
LinkDB
Position
3:12695311..12706458
AA seq 892 aa
MQPPTGAVSGSSSSSLECVSSCRTSWRGGGRPYECSVLSCAWNAPRALTGALASTTAQCS
SCSHAEAGAGWRRRGQSQRSNNSLLHITWAEGINRGKFGYGSSAHSFPTGNFFKSWSTSV
DPTWRVFCYSSSESFNHISPETLWEDLKPAISYLQPEELNFVHDALKLAYEAHNGQKRRS
GEPFIIHPVEVARILGEHELDWESIAAGLLHDTVEDTDMVTFERIENEFGVTVRRIVEGE
TKVSKLGKLQCKNEGNSKQDVKAEDLRQMFLAMTEEVRVIIVKLADRLHNMRTLTHMPQH
KQYAIAMETLQVFAPLAKLLGMYRIKSELEYLSFMYMNPGDFAELKKRVEDLYKAHEQEL
EEANQILGEKIAEDQFLDLVSVETQVRSVCKELYSIYKTALKSKSSINEINQVAQLRIII
KPKSCNGVGPLCTAQQICYHVLGLVHGIWTPIPQAVKDYIATPKPNGYQSLHTTVIPFLN
ESMFHLEVQIRTEDMDLIAERGIAAHYSGRGVVSGPVRPGISSGRNSNGKVICLNNTGFA
LRIGWLNAIREWQEEFVGNMSSREFVDTITRDLLGSRVFVFTPKGEIKNLPKGATVVDYA
YLIHTEIGNKMVAAKVNGNLVSPIHVLANAEVVEIIIYDKLSAKYAFQRHQQWLQHAKTR
SARHKIMKFLREQAALSAAEITADAVNNFVADLEDESDYEQSIPSSENKDYTFNWQKILN
SDKLSFGNKKSDCFLPVKNVSVPKVNGKHNKTVKELGIKINGSTFRGDSFTDFIHPGVSS
SKEVLPSVDNWKAGKICAWHNTEGSSIQWLCIVCVDRKGMVAEVSSALTACGITICSCVA
ERDKRRGIGVMLFHFEGAYENVVSACSGVDMILGVLGWSVGCSCNPLGVLEC
NT seq 2679 nt   +upstreamnt  +downstreamnt
atgcaacccccgacgggcgccgtgtcagggtcgtcgtcgtcgtcgctggagtgcgtgagc
tcgtgcaggacgtcgtggaggggcggagggaggccgtacgaatgcagcgtgctctcgtgc
gcctggaacgcgccgcgggcgctcacgggggcgctcgccagcaccaccgcgcagtgctcc
tcctgcagccacgccgaggctggggcagggtggaggcggcggggccagtcgcagcggagt
aacaattcgttactgcacataacctgggcagaaggcatcaacagggggaagtttggttat
ggttcatcagcccattcttttcccactggaaattttttcaaatcttggtcaacttccgtg
gatccaacatggagagttttctgctattcatcatctgaatcgttcaatcatatttctcca
gaaactttgtgggaggatctcaagccagctatctcgtaccttcaacctgaagaattgaac
tttgtacacgatgctctgaagttggcatatgaggcacataatgggcagaaacgccgaagt
ggggaacctttcattattcatcctgttgaagttgctcgtatccttggggagcatgaactt
gactgggaatcaatagctgctggtttattgcatgacactgttgaagatacagacatggtt
acttttgaaagaatagaaaatgagtttggtgtaaccgtacgccgtattgttgaaggggag
acaaaggtatctaagctaggaaaacttcagtgcaaaaatgagggtaattcaaaacaggac
gtcaaggctgaagatttaagacagatgtttcttgccatgacagaagaggttcgtgtaatc
attgtgaaactggcagacaggctgcataatatgcgtacactcacacatatgcctcagcac
aagcagtatgccattgccatggagacactgcaggtttttgcacccctagctaaacttctc
gggatgtatcgaataaagtctgagctagaatatctgtccttcatgtacatgaatcctggt
gatttcgctgaactaaagaaaagagttgaggacctctacaaggcccatgaacaagaattg
gaagaggcaaatcaaatcttaggggaaaagattgctgaggatcaatttcttgatcttgtt
agtgttgaaacacaagtgcgttcagtctgcaaagaactctacagcatttataaaactgcg
ctgaagtccaagagttcaataaatgagataaatcaggttgcacagctgcggatcatcata
aagccaaaatcctgcaatggtgtggggccattgtgcactgcacaacagatctgctaccat
gtccttggtcttgttcatggtatctggacacctatacctcaagctgtgaaagattacatt
gcaaccccaaagcctaatggataccaaagtctacacacgacagtgataccatttctgaat
gagagtatgttccatttggaagttcagataagaacagaggatatggatctcatagcagaa
agaggcattgctgcgcactacagtggaagaggggttgtttcagggcctgttcgtcctgga
atatcaagtggaaggaattcaaatgggaaagtgatatgtctgaacaatacaggctttgct
ctgaggattggttggctcaatgcaatccgtgaatggcaagaagagtttgttggtaacatg
agttctagggaatttgttgatactatcacccgagatcttctgggaagccgtgtctttgtg
tttacaccaaaaggcgagattaaaaacttgcctaagggggccactgtggttgattatgct
tacctgattcacacagaaattgggaacaaaatggtagctgcaaaggtgaatggcaatcta
gtttcaccaatccatgtacttgcaaatgctgaagttgtggagattataatttatgataaa
ttatctgctaaatatgcattccagcgtcaccagcagtggcttcaacatgcgaaaactcgc
agtgcaagacacaaaattatgaaattcttgcgggagcaagctgctctttctgctgctgaa
ataactgccgacgccgttaataactttgttgccgatcttgaagatgaaagtgactatgag
cagtcgattccaagctctgaaaataaggactatacattcaactggcagaagatattgaat
tctgacaaactatcctttggaaacaagaagagcgactgctttttacctgttaaaaatgtc
tctgtgccaaaggttaatgggaagcacaacaaaactgtcaaagaactgggcatcaaaatt
aatggttcaacatttcgtggtgatagcttcactgattttattcaccctggtgtttccagc
agtaaagaagttctccctagtgtggataactggaaagctggtaaaatttgtgcgtggcac
aatacagaaggcagctctatccaatggctctgcatagtgtgtgttgatcgaaaaggtatg
gttgcggaagtttcatcagctctaacagcgtgtggaatcaccatatgctcgtgtgtggcg
gagcgagataagagaaggggaataggtgtgatgttgttccactttgagggggcatatgag
aatgtggtcagtgcatgctccggtgttgatatgattcttggggttcttggttggtccgtt
ggatgcagctgtaatcctttgggtgttcttgaatgctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337888
Entry
4337888           CDS       T01015                                 
Name
(RefSeq) probable GTP diphosphokinase CRSH1, chloroplastic
  KO
K00951  GTP pyrophosphokinase [EC:2.7.6.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4337888
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.5  GTP diphosphokinase
     4337888
SSDB
Motif
Pfam: RelA_SpoT HD_4 EF-hand_5 EF-hand_1 EF-hand_7 EF-hand_6 SPARC_Ca_bdg DUF3117 SR-25
Other DBs
NCBI-GeneID: 4337888
NCBI-ProteinID: XP_015637549
UniProt: Q6ATB4
LinkDB
Position
5:3607508..3611374
AA seq 583 aa
MATAATTSAAAIPTGGGGRRQHPHPRRPGLRPRRLHRLRLPAQAAAAAAASSPSTSSSSS
SSSTPAEGGGRLVAELVGAFNELTGRMGEGLATSSSSRLLFRALKLALPALRDGDGGRAL
ARALAIAASLADLQMDAEVISAGILREALDAGAISMRDVKSEIGISTAHLLHESLRLKHA
PSKLDVLDDESASALRKFCLSYYDIRAVILELALKLDMMRHLDCLPRYLQRIKSLEVLKI
YAPLAHAVGAGNLSLELEDLSFRYLFPHSYDHIDQWLRSQETENKLLIDSYKEQLLQALK
DDDELSQIVQDISIQGRYKSRFSTMKKLVKDGRKPEEVNDILALRVILEPRCDGSSLDWG
PRACHRTHEIIQAMWKEVPGRTKNYVTRPKENGYQSLHVAIDVSEPGKMRPLMEIQIRTK
EMHKFAVGGEASHSLYKGGLTDPGEAKRLKAIMLAAAELAAMRLRDLPASDQGDSNCTNR
AFCQLDKNGDGRISIEELTEVMEDLGAGGKDAKELMHLLDANSDGSLSSDEFEAFQRQIE
LMRSLDDKDDRYRKILKEKLQTIDSAGLIQVYRKQLGDKLLVS
NT seq 1752 nt   +upstreamnt  +downstreamnt
atggcgaccgccgcgacgacctccgccgccgcaatccccaccggcggcggcggtcgccgg
cagcatccccacccgcgccgcccaggcctccgcccgcgccgcctccaccgcctccgcctc
cctgcccaagcagccgccgcggcggccgcctcttctccatccacgtcgtcgtcgtcgtcg
tcgtcgtctactccggcggagggaggagggcggctggtggcggagctggtgggcgcgttc
aacgagctgacggggaggatgggggagggcctggccacctcgtcgtcgtcgcgcctcctc
ttccgcgcgctcaagctcgccctccccgccctccgcgacggcgacggcggccgggctctc
gcccgcgcgctcgctatcgccgcctccctcgccgacctccagatggacgccgaagttatt
tcagccggaatactgagggaagcacttgatgcaggagcaataagcatgagggatgtcaaa
tctgagattgggatcagcacagctcatttgctgcacgagagtttacggcttaagcatgcc
ccttcaaagcttgatgtacttgatgatgaaagtgcaagtgcattgagaaagttttgtctt
tcttactatgacatccgagcagttatcttggaacttgctctaaagctcgatatgatgaga
caccttgactgcctcccgagatatcttcagcggataaagtctcttgaagtcctgaagata
tatgccccacttgcccatgctgttggagctggtaatctatcactggagctagaggatctt
tcatttcgctatttgtttccgcattcatatgaccatattgatcaatggttgaggagccaa
gagactgagaacaagctcttaatagattcgtacaaggagcagttgcttcaggcactgaaa
gatgatgatgagttgagccagattgtgcaagacatctcaattcaagggcggtataaaagc
cgtttcagtactatgaaaaagctagtaaaagatggcagaaaaccagaagaagtaaatgac
atactagctttaagggtaatcttagaacctcggtgtgatggcagctcgttagactggggc
cctagggcttgtcacaggacacatgaaatcattcaagctatgtggaaagaagttccagga
aggacaaaaaattatgtcacacggccaaaagaaaatggttaccagagcttgcatgtggcc
atcgatgtaagtgaacctgggaagatgaggccactgatggagatacagatacgaaccaag
gagatgcataaatttgctgttggtggagaggcatctcactctctctacaaaggtggactt
acagatcctggagaggctaaaaggctgaaggctatcatgttggctgcagcagagttagca
gctatgcgtcttcgtgacctcccagctagtgatcaaggagacagcaactgcacgaaccgt
gctttctgccagcttgataaaaacggtgatggaaggatcagtattgaggagctcacagag
gtgatggaagaccttggtgctgggggcaaagatgctaaggagctcatgcatcttctcgac
gcaaacagcgatggctccttgagctccgatgaattcgaagcattccagagacagatcgaa
ctgatgagaagcttggacgacaaagacgatcgctacaggaagatactgaaggagaagctg
cagacgattgacagcgcgggtctcattcaggtctaccgcaaacagctgggcgacaaactg
cttgtaagctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337890
Entry
4337890           CDS       T01015                                 
Name
(RefSeq) probable GTP diphosphokinase CRSH2, chloroplastic
  KO
K00951  GTP pyrophosphokinase [EC:2.7.6.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4337890
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.5  GTP diphosphokinase
     4337890
SSDB
Motif
Pfam: RelA_SpoT HD_4 EF-hand_5 EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_8 SPARC_Ca_bdg EF-hand_9
Other DBs
NCBI-GeneID: 4337890
NCBI-ProteinID: XP_015637728
UniProt: Q6ATB2
LinkDB
Position
5:3626399..3629126
AA seq 559 aa
MASAGGEVVVVDPAAAAVAPDVEHHAPAPRLTPAGSGGRLMAELLGVFNGLTERMGDDVA
TSSSWTLLFRALKLALPALRDAAGGRSLARALIVAASLADLQMDAEVISAGIVRQAMDAG
AVAMADAEAQLGPGAAALLLESLDVKNAPSRVDVADEEAASAVRNRILSGYDVRAVILEL
AIRLDAMKHLDGVPKHQQRTTSLEVLKVFAPLAHAVGAGALSKELEDLSFWRLYPQAYAQ
VDQWLSGQEDDCKRVLATCKDDLLQALAADDELRHTVAGFDVKGRYKSRFSAMKKLVKDG
RRPEDVHDILGMRVILDHRAGAGDGHRACIRTHEVIKGMWKDVPARTKDYIARPKGDGYR
SLHIAVDMSEPGPEGKKRPLMEVQIRTKEMNDAAVFGHALYKGCLADPEEAKRLKDIMLA
AAEVAAQHLRDEPATGDQTGVPAAAAAAASAGNIERAFRLLDKNGDGRISMEELTELMED
LGAGGKDAEELMRLLDDNNDGSLSSDEFALFQKRVELKAKLEDKDDEYKEILRQKLQKVD
DTGLIHVYRKNLSDKLVSG
NT seq 1680 nt   +upstreamnt  +downstreamnt
atggcgagcgccggcggtgaggtcgtcgtcgtcgacccggccgcggccgcggtggcgcct
gacgtcgagcaccacgcgccggcgccgcggctgactccggcgggcagcggcgggcggctg
atggcggagctgctcggcgtgttcaacgggctgacggagcggatgggggacgacgtcgcc
acctcgtcgtcgtggaccctcctcttccgcgcgctcaagctggcgctgcccgcgctccgc
gacgccgccggcggacgctccctcgcccgcgcgctcatcgtcgcggcgtccctcgccgac
ctccagatggacgccgaggtcatctcggcggggatcgtgaggcaggcgatggacgccggc
gcggtggccatggccgacgccgaggcgcagctcgggccgggcgccgccgcgctgctcctc
gagagcctcgacgtgaagaacgcgccgtcgcgggtcgacgtcgccgacgaggaggcggcg
agcgcggtgcgcaaccggatcctctccggctacgacgtccgcgccgtcatcctcgagctc
gccatcaggctcgacgccatgaagcacctcgacggcgtccccaagcaccagcagcgcacc
acctcgctggaggtgctcaaggtgttcgcgccgctggcgcacgccgtcggcgccggcgcg
ctctccaaggagctcgaggacctctccttctggcgcctctacccgcaggcctacgcccag
gtggaccaatggctgagcggccaagaagacgactgcaagcgcgtcctcgccacctgcaag
gacgacctcctccaggcgctcgccgccgacgacgagctccgccacaccgtcgccggcttc
gacgtcaaaggccgatacaagagccggttcagcgccatgaagaagctggtgaaggacggg
cggcggccggaggacgtgcacgacatcctcggcatgcgcgtcatcctggaccaccgcgcc
ggcgccggcgacggccaccgcgcgtgcatcaggacgcacgaggtgatcaaggggatgtgg
aaggacgtgccggcgaggaccaaggactacatcgcgcggcccaagggggacgggtaccgg
agcttgcacatcgccgtcgacatgagcgagccggggccggaggggaagaagaggccgctg
atggaggtccagatccgcaccaaggagatgaacgacgccgccgtctttggccacgccctc
tacaagggctgcctcgcggatcctgaagaggcgaaaaggctcaaggacatcatgctggcg
gcggcagaggttgcagcgcagcacctccgcgacgagccagccaccggcgaccagaccgga
gtccctgccgccgccgcagccgccgccagcgccggcaacatcgagcgagcattccggttg
ctggacaagaacggcgacgggaggatcagcatggaggagctgacggagctcatggaggac
ctcggcgccggcggcaaggacgccgaggagctcatgcgcctcctcgacgacaataacgac
ggctcgctcagctccgacgagttcgccctcttccaaaaacgggttgagctgaaggcgaag
ttggaggacaaggatgatgagtacaaggagatcctcaggcagaagctgcagaaggtcgac
gacacggggctcatccacgtctaccgcaagaacctcagcgacaagctcgtctccggctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343883
Entry
4343883           CDS       T01015                                 
Name
(RefSeq) probable GTP diphosphokinase RSH3, chloroplastic
  KO
K00951  GTP pyrophosphokinase [EC:2.7.6.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4343883
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.5  GTP diphosphokinase
     4343883
SSDB
Motif
Pfam: HD_4 RelA_SpoT HD ThiS
Other DBs
NCBI-GeneID: 4343883
NCBI-ProteinID: XP_015644642
LinkDB
Position
7:complement(25225861..25229459)
AA seq 591 aa
MAPATAISCAVVKCGGGGGPRQPRVSAPPRQQGHAAAAASLEQLLLLPRWSPPSSPLSFA
RPAAERVAARRARAAAVAMKVVEDATPPAAGAVLLAGAQSRHAIFRDELVRRAFYAAEAA
HRGQMRASGDPYLQHCVETAALLAELGAGPAVVAAGLLHDTVDDAGLGYGSLSVQFGAGV
ADLVKGVSNLSHLSKLARRNDTASRVDEADKLRTVFLAMEDARAVLIKLADRLHNMRTLD
SLPKVKQQCFAKETLEIFAPLANQLGILNWKEQLENLCFKYLYPELYEELSSNLLEFYNQ
DMIAAAIRRLEQALQVRGLCYHTISGRNKSMYSIYSKMARKKLDMDEIYDIHGVRVILDN
KADCFTTLEIVHHLWPRIPGKFKDYINSPKPNGYQSLHTVVLSEETLPLEIQIRTRDMHL
QAEFGIAAHWRYKEAVRNCCSSVPEMVEWVRWVVTWQCETLHIDHPSSLTHGAPPRAICS
CSSQSDDCPFSYSKRCDHSGPILVILLENEKMSVQEFPQNSTVLDLLKRTSSYDMQLRLR
LNCHVVHNLNQELKMGDVVELIPLAQCNPGAGGYAREFHQMYDHRLTVSQS
NT seq 1776 nt   +upstreamnt  +downstreamnt
atggcgccggcgacggcgatatcctgcgcggtggtcaaatgcggcggcggcggcgggccc
cgccagccccgcgtctccgccccgccgcggcagcagggccacgccgccgccgccgcctcg
ctggagcagctcctcctcctcccccgctggagcccgccgtcgtcgcccctgtccttcgcg
cggcccgccgcggaacgcgtggccgcgaggcgagcccgcgccgccgccgtggcgatgaag
gtggtggaggacgccacccctcccgcggcgggggcggtgcttctcgccggggcgcagtcg
aggcacgcgatattcagggacgagctcgtgaggagggccttctacgccgccgaggcggct
caccgcggccagatgcgcgcgagcggtgacccttacctgcagcactgcgtggagacggcg
gcgctgctcgcggagctcggcgccggccccgccgtcgtcgccgcagggctgctgcacgac
acggtcgacgacgcaggcctcggctatggctcactctccgtccaatttggcgctggtgtc
gccgaccttgtgaagggggtttcaaatctaagtcatttgagcaaactggctcgtagaaat
gatacagccagcagagtagatgaagctgacaaattgcgtacggttttccttgcaatggag
gatgcgagagcagttctcatcaaacttgctgacagactacacaacatgaggacgttggat
tctttgcctaaggtcaaacaacagtgctttgcaaaggaaacgctggagatatttgctccg
ttggcaaatcagcttgggatcttgaattggaaggaacagcttgaaaatctgtgcttcaag
tatctttaccctgagctatatgaggaactgtcatccaaccttctcgagttctacaaccaa
gatatgattgcagctgcaataaggcgactggaacaagcccttcaagtgaggggactatgc
tatcatactatatcagggaggaacaagagcatgtacagtatctacagcaagatggcaagg
aagaaactggacatggatgaaatctatgatatacatggggtgcgtgttatactcgataac
aaagctgattgtttcaccactttagagattgtccatcacttgtggcctagaattcctggc
aaattcaaagactacatcaacagccccaaacccaatgggtatcaatccctgcacacggtt
gttctcagtgaagaaacactgccattggagatccaaattcgtacgagggacatgcattta
caggcagaatttggaattgctgcacattggagatacaaggaagctgttcgaaattgttgt
tcatctgttcctgaaatggtggaatgggttagatgggttgttacatggcagtgcgaaact
ctgcacatagatcacccttcctctcttacacatggagctccaccaagggcaatatgcagt
tgttcttctcagtctgatgactgtcctttttcgtattcaaaacgatgtgaccacagtgga
ccaatcctagtaatattactggagaatgaaaagatgtcagtgcaagaattccctcaaaat
tcaactgtactggacctactgaagaggacttctagctatgacatgcagttgaggttaaga
ctgaactgccatgtcgtgcacaacttgaaccaagagcttaaaatgggtgacgtggtcgaa
ctgatccctttggctcaatgcaatcctggagctggaggttatgcgagggagttccaccaa
atgtatgaccaccggctcacagtttcgcagtcgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345756
Entry
4345756           CDS       T01015                                 
Name
(RefSeq) probable GTP diphosphokinase RSH2, chloroplastic
  KO
K00951  GTP pyrophosphokinase [EC:2.7.6.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4345756
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.5  GTP diphosphokinase
     4345756
SSDB
Motif
Pfam: HD_4 RelA_SpoT HD
Other DBs
NCBI-GeneID: 4345756
NCBI-ProteinID: XP_015650642
UniProt: Q7XAP4
LinkDB
Position
8:22446503..22450469
AA seq 718 aa
MSVPAIAVYTSPPGAVYTSSSSSELEASSRGSAPCATAAPPSPASSHRHQAIAGGLSCLF
SSPTAAPRAAAAQDELGALWHDRSGEATAVGGGGGGGGYSYPQPSSPFKWRDMLHHSPVP
LFHSPASSPASRSPSASWLAGRERERLFSSFVRNALGSCVDYAPVAALPLGVSAAVGVGA
GELAFELDEHLSEAEPSCEPYARDLLAGAQARHRIFHDELVVKAFFEAERAHRGQTRASG
DPYLQHCVETAVLLAKIGANATVVSAGLLHDTIDDSFMDYDQIFRMFGAGVADLVEGVSK
LSHLSKLARDNNTASRTVEADRLHTMFLAMADARAVLIKLADRLHNMKTIEALPLVKQQR
FAKETMEIFVPLANRLGIASWKDQLENICFKHLNPEEHKELSSKLVISFDEALLTSTLDK
LDKGLRDEGISYHSLSGRHKSLYSIYSKMIKKNLTMDDVHDIHGLRLVVDTEQDCYQALD
IVHKLWPRVAGRFKDYILHPKLNGYRSLHTVIMCEGIHPFEVQIRTKEMHLQAEYGFAAH
WRYKEGGCKHSFVLQMVEWARWVLTWQCEAMSKERSSGLGRSDAIRPPCPFPSHSEDCPY
SYTRQCNHDGPIFVIMLEHDKMSVQELPANSTVVDLMERVGANSPRCSPYSFPLKEELRP
RVNHKPISDPNRKLCMGDVVELTPALPHKSLTEYREEIQRMYERGGFALATTRDGPAS
NT seq 2157 nt   +upstreamnt  +downstreamnt
atgtccgtgccggcgattgccgtgtacaccagcccgccgggggcggtctacacgtcgtcg
tcgtcgtcggagcttgaggcgagctcccggggctcggcgccgtgcgccaccgcggctccc
ccgtcgccggcgagctcccaccgccaccaggccatcgctggtgggctatcctgcctcttc
tcctcacctaccgccgcccctcgcgccgccgcggctcaggacgagctgggcgcgctctgg
cacgatagatccggcgaggcgacggccgtcggcggcgggggcgggggcgggggctactcc
tacccgcagccgtcgtcgccgttcaagtggcgggacatgctccaccacagccccgtgccg
ctgttccacagcccggcctcctcgccggcgtcacggagcccctcggcgtcctggctcgcc
ggccgcgagcgcgagcggctcttctccagcttcgtgcgcaacgcgctcggctcctgcgtc
gattacgcgccggtcgccgcgctgccgctcggcgtctcggctgctgtcggtgtcggtgcc
ggcgagctcgcgttcgagctcgacgagcacctctccgaggcggagccgtcgtgcgagccg
tacgctcgcgacctcctcgccggcgcccaggctcgccaccgcatcttccacgacgagctc
gtcgtcaaggccttcttcgaggctgagagggcgcaccgaggccagacgcgggcgagtggt
gatccgtacttgcagcattgtgtggagaccgccgtgcttctagccaagataggcgcaaac
gcgaccgtcgtctctgccggactcctgcatgacaccattgatgatagcttcatggattat
gatcagattttccggatgtttggtgccggcgtggctgatctagttgaaggggtctccaag
ttaagccacttgagcaaacttgctcgggacaacaatactgcaagcagaaccgttgaagca
gaccgcctgcatacaatgtttcttgcaatggctgatgcaagagcagttctgataaagcta
gcagatcgtctacacaacatgaagacaatagaagctttgcctttggtcaaacaacaaaga
ttcgctaaggagactatggagatatttgtgccgttggctaatcggttaggaatcgctagc
tggaaagaccagctggaaaatatttgctttaagcatttgaacccagaggagcacaaggag
ctttcctccaaacttgtcatatcttttgacgaagcacttcttacatctactctggataaa
cttgataaaggtctaagagatgaaggtatttcgtatcacagtctttctgggaggcacaag
agcctgtacagcatatactccaagatgataaagaagaacttaacgatggatgatgttcat
gacattcatggtctacgtcttgtggttgatacagagcaggattgttaccaagctcttgac
attgtccataagctctggccccgagttgctggacgatttaaggactatatcctgcatcca
aaattgaatgggtatcggtcattgcacactgtcatcatgtgtgagggcatacacccattt
gaagttcagatccgaacaaaagaaatgcatctacaagcagagtatggatttgctgcacac
tggagatacaaggaaggtggttgcaagcactcttttgtactccaaatggtggaatgggca
agatgggtgctcacatggcaatgcgaagcaatgagcaaagagcggtcctcaggtttaggc
cgctctgatgccattaggccaccatgtccatttccctcgcattcggaggactgcccttat
tcttacactcgccagtgcaaccacgatggacccatctttgtgattatgcttgaacatgat
aagatgtctgtccaagagcttcctgcgaactcaactgtagtcgatctgatggagagagtg
ggggccaatagtccaagatgcagcccttacagcttcccactgaaagaggaattgcgcccg
agggttaaccacaagcccataagtgaccctaaccggaaactgtgcatgggagatgtggtg
gagctgacgcctgcgctcccacacaagtcgctaactgagtatcgggaagagatccagcgc
atgtatgaacgaggcgggtttgccctcgccaccacccgggacggtccggcaagctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347182
Entry
4347182           CDS       T01015                                 
Name
(RefSeq) probable GTP diphosphokinase RSH3, chloroplastic
  KO
K00951  GTP pyrophosphokinase [EC:2.7.6.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4347182
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.5  GTP diphosphokinase
     4347182
SSDB
Motif
Pfam: HD_4 RelA_SpoT HD
Other DBs
NCBI-GeneID: 4347182
NCBI-ProteinID: XP_015611622
UniProt: Q67UU0
LinkDB
Position
9:16455346..16458589
AA seq 708 aa
MSLPAISLYTSPPPGAVYSSEFDPSSRGSSPPCSTAPPSTSHRPPAAAGGLSCLFSSPAA
AASPPRAPPHDELGALWQDRSDEPAFAGGGGGYSSSPLKWRDLHHHHHHSPVSVFQGPSS
SPAASRSPPASWLAGRDRDRERLFAGFVRNALGSCVDYAPALSPRSEVGGGELAFELDEN
LAEASPACEPCARELLAGAQARHRIFHEELVVKTFFEAEKAHRGQTRASGDPYLQHCVET
AVLLANIGANSTVVSAGLLHDTIDDSFIDYDHIFHMFGAGVADLVEGVSKLSHLSKLARD
NNTASRIVEADRLHTMLLAMADARAVLIKLADRVHNMKTLEALPLGKQQRFAKETMEIFV
PLANRLGIASWKDQLENLCFKHLNPEEHKDLSSKLTKSFDEVLITSAVDKLDRGLRDAGL
SYHNLSGRHKSLYSIHNKMLKKNLTMDEIHDIHGLRLVFEKEEDCYRALDVVHELWPQVP
GRFKDYISRPKLNGYRSLHTVVMSENVHPFEVQIRTKEMHLQAEYGFAAHWRYKEGTCRH
SFVLQMVEWARWVLTWQCEAMNKERPASLGDSDAIRPPCPFPMHSEDCPYSYTRQCDHDG
PIFVILLEHDKMSVQEFQANSTVMNLMDRVGTNTPRWSPYRIPMKEDLRPKVNHEPISDL
NRKLSMGDVVELTPALPHESLPNYREEIQRMYDRGGFALATRGGSSRR
NT seq 2127 nt   +upstreamnt  +downstreamnt
atgtcgttgccggcgatttccctgtacaccagcccaccaccgggcgccgtctactcgtcg
gagttcgatccgagctcccgcggctcgtcgccgccctgctccaccgcgccgccgtccacc
tctcaccgcccgcccgccgccgcgggcgggctgtcctgcctcttctcctccccggccgcg
gcggcctcgccgcctcgtgccccgccgcacgacgagctcggtgcgctgtggcaagataga
tccgacgagcccgccttcgccggcggcggcggcggctactcgtcctcgccgctcaagtgg
cgtgacctccaccaccaccatcaccacagccccgtgtcggtgttccagggcccgtcgtcc
tctccggcggcctcccgcagcccgccggcgtcgtggctcgccggccgcgaccgcgaccgc
gagcgcctcttcgccggcttcgtgcgcaacgcgctgggctcctgcgttgactacgccccg
gcactcagcccgcggtcggaggtcggcggcggcgagctcgcgttcgagctcgacgagaac
ctcgcggaggcgagccccgcctgcgagccgtgcgcccgggagctcctcgccggcgcccag
gctcgccaccgcatcttccacgaggagctcgtcgtgaagaccttcttcgaggccgagaag
gctcaccgtggccagacccgggcgagtggcgatccatacttgcaacattgtgtagagaca
gccgtgcttctggccaatattggggcgaattcgacggtcgtctccgccgggcttctgcac
gacaccattgacgattcattcattgattatgatcacatctttcacatgttcggagccggc
gtggccgatctcgttgagggggtctcaaagttgagccacttgagcaaacttgctcgtgat
aacaacacagcaagcaggattgttgaagcagatcgattgcacacaatgcttcttgcaatg
gctgatgcacgggcagttctaataaaattagctgaccgtgtgcataacatgaaaactttg
gaagctttacctcttggtaaacaacaaagatttgctaaggagaccatggagatctttgtt
cctttggctaatcgattagggattgccagctggaaagaccagttggaaaatctttgcttc
aagcatctgaatccagaagagcacaaggatctatcatctaaactaaccaaatcctttgac
gaagtgctaatcacatctgctgtggacaaactagatagaggtctgagggatgcaggcctc
tcatatcacaatctttctgggaggcacaaaagcctatacagtattcacaacaagatgcta
aagaagaatttgacaatggatgagatccatgatatccatggcctgcgtctcgtgtttgag
aaggaggaagattgctatcgagcacttgatgttgttcatgaactatggccccaagttcct
ggaagatttaaggactacatatctcgtccaaaattaaatgggtatcgatcattgcacact
gttgtcatgagcgagaatgtccacccatttgaagtccagatccgtacaaaagagatgcac
ctgcaagctgagtatggattcgcagcacactggaggtacaaggaaggcacctgtaggcac
tcctttgtactccagatggtggaatgggctaggtgggtgcttacatggcaatgtgaagca
atgaacaaagaacgacctgcatctctaggcgacagtgatgcaattaggccaccctgtcca
tttcccatgcattcagaagactgcccttactcatatactcggcaatgcgaccatgatgga
ccgatatttgtcatcctactggaacatgacaagatgtctgtgcaagaattccaagcaaac
tcaactgtaatgaacctcatggatcgagttgggaccaacactccaagatggagtccctac
cgcatccccatgaaggaagatctgcgaccgaaggttaaccacgagcccataagcgatctg
aaccggaagctcagcatgggggatgtggtggagctgacaccggcccttcctcacgagtcg
ctccccaattaccgggaggagattcagcgcatgtacgaccgtggcggattcgccctcgcc
acccggggtggcagctcgaggcggtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9270381
Entry
9270381           CDS       T01015                                 
Name
(RefSeq) probable GTP diphosphokinase CRSH3, chloroplastic
  KO
K00951  GTP pyrophosphokinase [EC:2.7.6.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    9270381
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.5  GTP diphosphokinase
     9270381
SSDB
Motif
Pfam: RelA_SpoT HD_4 EF-hand_5 EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 SPARC_Ca_bdg Dockerin_1
Other DBs
NCBI-GeneID: 9270381
NCBI-ProteinID: XP_015638151
UniProt: Q75IS2
LinkDB
Position
5:3638102..3640506
AA seq 578 aa
MANAGVNETVAVAVAIDAPGVGHDHGAAGEVRRPSTRRLAPAGSGGRLMAELLGVFNGLT
ERMGEDVATSSSSRLLFRALKLALPALRDGGGDGGGGQSVSRALVVAASLADLQMDAEVI
SAGMVRGALDTGALAMADVEAQLGASAAGLVEESLKVKRAPSEVDVADEEAASALRKRCL
SSYDIRAVILELAVKLDAMKHLDVLPKHQQRTTSLEVLKVFALLAHAVGAGELSLELEDL
SFQRLYPQAYAHIDQWLSSQEDDCKRVIAASKEELLRALTADDELRCTVTGVDVMGRYKS
RFSTMKKLVKDGRRPEDVNDILGMRVILDPRPGGGGGGDGDGGDRACLRTHEVIKAMWKD
VPARTKDYITRPKGNGYRSLHVAVDMSEPGPEGKKRPLMEIQVRTREMDMAAVGGQASHA
LYKGGLTDPEEAKRLKAIMLAAAEVAAQHLRDEPAGDGGQTTAAASAATAGNVERAFQLL
DKNGDGRISMEELTEIMEDLGAGGHDAEELMRLLDANSDGSLSSDEFALFQKRVKLKTKL
ENKDDEYKEILKQKLQKVDDTGLIHVYRKNLSDKLVLV
NT seq 1737 nt   +upstreamnt  +downstreamnt
atggcgaacgccggtgtcaatgagacggtcgccgtcgccgtcgccattgacgcacctgga
gttgggcatgaccatggtgccgccggcgaggttcgtcgtccgtcgacgcgccggctggct
ccggcgggaagcggcgggcggctgatggcggagcttcttggcgtgttcaatggactgacg
gagcggatgggggaggacgtggcgacctcgtcgtcgtcgcggcttctcttccgcgcgctc
aagctggcgcttcccgcgctccgcgacggcggcggcgatggcggcggcggccagtccgtc
tcccgtgcgctcgtggtcgccgcctccctcgccgacctccagatggacgcggaggtcatc
tcggctggcatggtgaggggagctctggataccggggcactcgccatggccgacgtcgag
gcgcagctcggtgccagcgccgccggtctggtggaagagagcctcaaggtgaagcgcgcg
ccgtcggaggtcgacgtcgccgacgaggaggccgcgagcgcgctgcggaagcggtgcctc
tccagctacgacatccgcgccgtcatcctggagctcgccgtcaagctcgacgccatgaag
cacctcgacgtcctccccaagcaccagcagcggaccacctcgcttgaggtgctcaaggtg
ttcgcgctgctggcgcacgccgtcggcgccggcgagctgtcgctggagctcgaggacctc
tccttccagcgcctgtacccgcaggcctacgcccacatcgaccagtggctgagcagccaa
gaagacgactgcaagcgcgtcatcgccgcgtccaaggaggagctcctccgcgcgctcacc
gccgacgacgagctccgctgcaccgtcaccggcgtcgacgtcatgggccggtacaagagc
cggttcagcaccatgaagaagctggtgaaggacggccggcggccggaggacgtgaacgac
atcctcggcatgcgcgtcatcctggaccctcgccccggcggcggcggcggcggcgacggc
gacggcggcgacagggcatgcctgcggacgcacgaggtgatcaaggccatgtggaaggac
gtgccggcgaggaccaaggactacatcacgcgtcccaaggggaacgggtaccggagcttg
cacgtcgccgtcgacatgagcgagccggggccggaggggaagaagaggccgctgatggag
atccaggtgcgcaccagggagatggacatggccgccgtcggcggccaggcgtcgcacgcg
ctctacaagggcggcctcaccgatcctgaggaggccaagaggctcaaggccatcatgctg
gcggcggcggaggtggcagctcagcacctccgcgacgagccagccggcgacggtggtcaa
acaaccgccgccgcctccgccgccaccgccggcaatgtcgagcgagcgttccagctgctc
gacaagaacggcgacgggaggatcagcatggaggagctaaccgagatcatggaggacctc
ggcgccggcggccatgacgccgaggagctcatgcgcctcctcgacgccaacagcgacggc
tcgctcagctccgacgagttcgcgctcttccagaaacgggttaagctgaagacgaagtta
gagaacaaggatgatgagtacaaggagatcctcaagcagaagctgcagaaggttgacgac
acggggctcatccacgtctaccgcaagaacctcagcgacaagttggtcctcgtttga

DBGET integrated database retrieval system