KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332793
Entry
4332793           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L18-3
  KO
K02883  large subunit ribosomal protein L18e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4332793
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4332793
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4332793
  Archaea
    4332793
SSDB
Motif
Pfam: Ribosomal_L18 Ribosomal_L27A
Other DBs
NCBI-GeneID: 4332793
NCBI-ProteinID: XP_015631625
UniProt: Q10LN7 A0A8J8Y877
LinkDB
Position
3:complement(12715883..12718479)
AA seq 187 aa
MGIDLVAGGRNKKTKRTAPKSDDVYLKLIVKLYRFLVRRTKSPFNAVILRRLFMSKTNRP
PLSLRRLVRFMEGKENQIAVIVGTVTDDKRVYEVPAMKVAALRFTETARARIVNTGGECL
TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSNTKPYVRSKGRKFEKARGRR
NSKGFKV
NT seq 564 nt   +upstreamnt  +downstreamnt
atgggtatcgacctcgtcgccggcggccggaacaagaagaccaagcgcacggcgcccaag
tccgacgatgtctacctcaagctcatcgtcaagctctaccgcttcctggtgcggaggacc
aagagccccttcaacgccgtgatcctgaggcggctcttcatgagcaagaccaaccgcccg
ccgctctcgctccgccgcctcgtcaggttcatggagggcaaggagaaccagatcgccgtg
atcgtgggcaccgttaccgacgacaagagggtctacgaggtgccggcgatgaaggtggcc
gcgctcaggttcaccgagaccgcgagggctcgcattgtgaatactggtggagagtgcctt
accttcgatcagctggcgctccgcgctcctctgggccagaacacggttctcctgaggggt
cctaagaacgccagggaagcagtgaagcactttggtcctgctcctggagtgccacacagc
aacaccaagccttacgtgcgctcaaagggaaggaagtttgagaaggcgagaggaaggagg
aacagcaaaggcttcaaggtctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337849
Entry
4337849           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L18-3
  KO
K02883  large subunit ribosomal protein L18e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4337849
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4337849
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4337849
  Archaea
    4337849
SSDB
Motif
Pfam: Ribosomal_L18 Ribosomal_L27A
Other DBs
NCBI-GeneID: 4337849
NCBI-ProteinID: XP_015639202
UniProt: A0A0P0WI96 Q5WMY3
LinkDB
Position
5:3230229..3232780
AA seq 188 aa
MGIDLVAGGRNKKTKRTAPRSDDVYLKLLVKLYRFLVRRTKSNFNAVILKRLFMSKTNRP
PLSLRRLAKFMEGKEENNIAVIVGTVTDDKRIQEIPKMKVTALRFTETARARIVNAGGEC
LTFDQLALRAPLGENTVLLRGPKNAREAVRHFGKAPGVPHSHTKPYVRSKGRKFEKARGR
RNSRGFKV
NT seq 567 nt   +upstreamnt  +downstreamnt
atgggtatcgacctcgttgccggcgggaggaacaagaagacgaagcgcaccgcgccgagg
tcggacgatgtctacctcaagctcctcgtcaagctgtaccgtttcctggtgaggagaacc
aagagtaacttcaatgccgtgatcctcaagaggctcttcatgagcaagaccaaccgcccg
ccgctctccctgcgccgcctcgccaagttcatggaaggcaaggaggagaacaacattgct
gtgattgttggtacagtcactgatgacaagaggatccaagagattccgaaaatgaaggtt
actgccctgaggttcacggagacggctagggcaaggattgtcaatgctggcggcgagtgc
ctcaccttcgaccagcttgctctccgtgctccgcttggggagaacacggtcctcttgagg
ggtcccaagaatgcccgtgaggccgtcaggcactttggtaaggctcctggtgtgccgcac
agccacacgaagccatatgtgcgctccaagggaaggaagttcgagaaggcccgtggcagg
aggaacagccgtggattcaaggtctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344265
Entry
4344265           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L18-3 isoform X1
  KO
K02883  large subunit ribosomal protein L18e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4344265
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4344265
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4344265
  Archaea
    4344265
SSDB
Motif
Pfam: Ribosomal_L18 Ribosomal_L27A
Other DBs
NCBI-GeneID: 4344265
NCBI-ProteinID: XP_015644690
UniProt: Q0D3P2 Q6ZDW5
LinkDB
Position
7:28537512..28540098
AA seq 195 aa
MGIDLVAGGRNKKTKRTAPRSEDVYLKLIVKLYRFLVRRTKSHFNAVILKRLFMSKTNRP
PLSMRRLVRFMEGKVPDRHAISGDQIAVIVGTVTDDKRIYEVPAMKVAALRFTETARARI
INAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSNTKPYVRSKGRK
FEKARGRRNSKGFKV
NT seq 588 nt   +upstreamnt  +downstreamnt
atgggtatcgacctcgtcgccggcggccggaacaagaagaccaagcgcacggcgcccagg
tccgaggatgtctacctcaagctcatcgtcaagctctaccgcttcctggtgcggaggacc
aagagccacttcaacgccgtgatcctgaagcggctcttcatgagcaagaccaaccgcccg
ccgctctcgatgcgccgtctcgtcaggttcatggaggggaaggtacctgatcgccatgcc
atttcgggggaccagatcgccgtgatcgtgggcaccgtcacagatgacaagaggatctat
gaggtgccggcgatgaaggtggctgctctcaggttcaccgagaccgcgagagcacggatc
atcaatgccggtggcgagtgcctcacgttcgaccagctcgctctccgcgccccgcttggc
cagaacacggtcctcctgaggggtcccaagaacgctagggaagctgttaagcactttggc
cctgctccaggagttccccacagcaacactaagccatatgttcgctcaaagggaaggaaa
tttgagaaggcaagaggaagaaggaacagcaagggcttcaaggtataa

DBGET integrated database retrieval system