KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332843
Entry
4332843           CDS       T01015                                 
Name
(RefSeq) divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic
  KO
K19073  divinyl chlorophyllide a 8-vinyl-reductase [EC:1.3.1.75]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00860  Porphyrin metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin metabolism
    4332843
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.75  3,8-divinyl protochlorophyllide a 8-vinyl-reductase (NADPH)
     4332843
SSDB
Motif
Pfam: NAD_binding_10 Epimerase NmrA GDP_Man_Dehyd 3Beta_HSD NAD_binding_4 adh_short RmlD_sub_bind KR Polysacc_synt_2
Other DBs
NCBI-GeneID: 4332843
NCBI-ProteinID: XP_015632323
UniProt: Q10LH0
LinkDB
Position
3:complement(13155797..13157547)
AA seq 405 aa
MAALLLSSHLTAASSSSTTSPTARPAPSFVSFRAANAAPKGARRGWPFLASSVEPPPAAS
AAQPFRSLAPSETTVLVTGATGYIGRYVVRELLRRGHPVVAVARPRSGLRGRNGPDEVVA
DLAPARVVFSDVTDAGALRADLSPHGPIHAAVCCLASRGGGVRDSWRVDYRATLHTLQAA
RGLGAAHFVLLSAVCVQKPLLEFQRAKLRFEGELAAEASRDPSFTYSIVRPTAFFKSLGG
QVETVKNGQPYVMFGDGKLCACKPISEEDLAAFIADCISDEGKANKILPIGGPGKALTPL
EQGEMLFRLLGREPRFIKVPIQVMDAAIWVLDALAKVFPGVEDAAEFGKIGRYYASESML
VLDPDTGEYSDEMTPSYGSDTLEQFFERVIREGMAGQELGEQTIF
NT seq 1218 nt   +upstreamnt  +downstreamnt
atggctgccctcctcctctcctcccacctcaccgccgcctcctcatcctccaccacgtcc
cccactgctcgaccggcgccaagcttcgtctccttccgcgccgccaacgccgcccctaag
ggtgcccgtcggggttggcctttccttgcttcgtcggtagagccaccgcctgctgcgtcg
gcggcgcagccgttccggtcactggcgccgtcggagaccaccgtgctggtcacgggcgcc
acgggctacatcgggcgttatgtcgtccgcgagctcctccgccgcggccaccccgtggtc
gccgtggcgcgcccccggagcgggctgcgcggccgcaacggccccgacgaggtcgtcgcg
gacctcgcccccgcccgcgtcgtcttctccgacgtcaccgacgcgggcgcgctccgcgcc
gacctgtcgccgcacggccccatccacgccgcggtgtgctgcctcgccagccgcggcggc
ggcgtgcgggactcgtggcgcgtggactaccgcgccacgctgcacaccctccaggcggcg
cgcggcctcggcgccgcgcacttcgtcctcctctccgccgtctgcgtccagaagccgctc
ctcgagttccagcgcgccaagctcaggttcgagggcgagctcgccgccgaggcgtcgcgc
gacccgtccttcacctacagcatcgtccgccccaccgccttcttcaagagcctgggcggc
caggtcgagaccgtcaagaacggccagccctacgtcatgttcggcgacgggaagctctgc
gcctgcaagcccatcagcgaggaggacctcgccgcgttcatcgccgactgcatctccgac
gagggcaaggccaacaagatcctccccatcggcgggccggggaaggcgctgacgccgctg
gagcaaggggagatgctgttccggctgctggggcgcgagcccaggttcatcaaggtgccg
atccaggtcatggacgccgccatctgggtgctcgacgcgctggccaaggtgttccccggg
gtggaggacgcggcggagttcggcaagatcgggaggtactacgcgtcggagagcatgctg
gtgctcgacccggacaccggcgagtacagcgacgagatgacgcccagctacggcagcgac
acgctcgagcagttcttcgagagggtgatcagggaaggcatggcagggcaggagctcggc
gagcagaccatcttctag

DBGET integrated database retrieval system