KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332988
Entry
4332988           CDS       T01015                                 
Name
(RefSeq) apoptotic chromatin condensation inducer in the nucleus
  KO
K12875  apoptotic chromatin condensation inducer in the nucleus
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03013  Nucleocytoplasmic transport
osa03015  mRNA surveillance pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4332988
  09122 Translation
   03013 Nucleocytoplasmic transport
    4332988
   03015 mRNA surveillance pathway
    4332988
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4332988
   03041 Spliceosome [BR:osa03041]
    4332988
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     4332988
Spliceosome [BR:osa03041]
 Complex C
  Other components
   EJC/TREX
    4332988
SSDB
Motif
Pfam: RSB_motif SAP
Other DBs
NCBI-GeneID: 4332988
NCBI-ProteinID: XP_015631513
UniProt: Q10KI0
LinkDB
Position
3:complement(15214227..15219079)
AA seq 715 aa
MSSYPVLNNRPIDQWRVTDLKDELRKRRLPVKGLKDELVRRLFESIQSEKEEEEEEQDNE
TVEVNPAANQASEIQSVSQETTVSITEVHKETVVQVTQEATPPITEVSQSLTVSAAEEPP
KVNAVATHEAPLSKAPTDKGEEPPIAGDVSTVENEHLHAENNTEPFVEKTQDVGTNEAIG
ALDMTSADVESDMTSSDIKIDATEASKVQQHDTVATTVDAIPTDADPMDTDVATEKAVLN
DLGDTTSVYDEERKDSELTNEDEKPIAPKPNDQVPEVSPDLGSPIKCESISSDDISTNKK
NNIKDNLNANNFDLELEAKPEMVKPSSGITSIGGDLQPLDDDKDLGKNQSSLEYIDSTAN
VDEGGSPEKLNLDRSSGDESMEEDVMEIKQVESNIKSEGTAELSSDHVKEVSLPDTVVDN
SSVDTKEVIADEKTAASTEKRKLEAEETVAATEPIKRQRRWAADGAKVPERQPISHSGSD
APKENFQPALKRSFGRSDSTASGDSPKERVVPPSQKPATASLRIDRFVRPFTLKAVQELL
GKTGSLCSFWMDHIKTHCYVTFSSVEEAVATRDAVYDLQWPPNNGNRLVAEFVDPQEVKL
KLEPPPPAAAPISPATTPKEPPFQQAQANQNMPRQAAAPREHLPPPPPLTTLPTSDSGSA
KERLPPTPKKQPEPPVVTLDDLFRKTHSSPRIYYLPLSEEEVAAKLASQGKGKRE
NT seq 2148 nt   +upstreamnt  +downstreamnt
atgtcatcataccctgtgctaaacaacagacctattgatcaatggagagttactgatctg
aaggatgaacttcgtaagaggaggctccctgttaaaggcttgaaagatgaacttgtaagg
cgactcttcgagtcaattcagagtgaaaaagaagaagaagaagaagaacaagataatgaa
actgtcgaagtgaatccagcagctaaccaggcatctgaaatacagagtgtttctcaggaa
actacagtttctattacagaagttcacaaggaaactgtggttcaagtaactcaggaagct
acacctcctatcactgaagtaagtcagtcgctcacagtttcagctgccgaagagcccccc
aaggttaacgcggtggcaacccatgaagctcccttaagcaaggccccaacagacaaagga
gaagagccaccaattgcaggagatgtttccacagtggaaaacgaacatcttcatgctgaa
aataatactgaaccttttgttgagaagacacaagatgttggcaccaacgaagcaattggt
gcccttgatatgaccagtgctgatgtagagtcagacatgacctcttctgatatcaagata
gatgctactgaagccagcaaagttcaacaacatgacacagtagcaacaactgtggatgcc
atcccaacagatgctgatcctatggatactgatgttgcaactgagaaggcggttcttaat
gatttgggtgacactacttcagtgtatgatgaagagcgcaaagattctgagctcacgaat
gaggacgagaagcccatcgcaccaaaaccaaatgatcaggtacctgaggttagcccagat
ttagggtctccaattaagtgtgagtcaatttctagcgatgatatatcaactaacaaaaag
aataatataaaggataatttgaatgctaataattttgatttagaactagaggctaagcca
gagatggtaaaaccatcttctggcattacttccataggtggagatttgcagccattggat
gatgacaaagatctgggtaaaaaccagtcatctttggaatacatagattccacagctaat
gtggatgaaggcggctctccagagaaactaaatttagacaggagttcaggtgatgagtca
atggaggaggatgtcatggagattaagcaagttgagtccaacattaaatctgaaggaaca
gctgagcttagctcagatcatgtgaaagaggtgtccctccctgatactgttgtggacaat
tcctctgttgacacgaaagaagttatagctgatgaaaagacagcagcttcaactgaaaag
aggaaactcgaagctgaagaaactgttgctgccactgagccaatcaaacgccagcgtcga
tgggctgcagatggtgccaaagttccagagagacaaccaataagtcatagtggctctgat
gctcctaaggaaaattttcagcctgctttaaaacgatcttttggcaggtctgattcaaca
gctagtggagattccccaaaggagcgggttgtgccaccatctcagaaacctgcaacagct
tccttgagaattgatcgatttgtaaggccatttacgctgaaggctgtgcaagaacttctt
ggtaaaactggatctctttgtagtttctggatggatcacatcaagacccactgctatgtt
acgttttcatcagtagaggaagctgtggctactcgggatgctgtctacgatttgcagtgg
ccaccaaacaacggcaatcgtttggttgctgaatttgttgatccccaggaagtgaagctc
aaacttgaacctcctccgccagcggcggctcctattagccctgctactacaccaaaggag
ccaccctttcaacaggctcaggctaatcaaaacatgcctcgtcaagccgctgcaccaagg
gagcacttgccacctccaccgcctcttactacgcttcctacatctgactcaggatcagca
aaggagaggcttccacccaccccaaagaaacagccggaacctcctgttgtgacactcgat
gatctcttcaggaagacacattcttctcctaggatttattaccttcctttatcagaagag
gaagtggcagccaagcttgcttcacagggcaaaggcaagagagaatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343967
Entry
4343967           CDS       T01015                                 
Name
(RefSeq) protein starmaker isoform X1
  KO
K12875  apoptotic chromatin condensation inducer in the nucleus
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03013  Nucleocytoplasmic transport
osa03015  mRNA surveillance pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4343967
  09122 Translation
   03013 Nucleocytoplasmic transport
    4343967
   03015 mRNA surveillance pathway
    4343967
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4343967
   03041 Spliceosome [BR:osa03041]
    4343967
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     4343967
Spliceosome [BR:osa03041]
 Complex C
  Other components
   EJC/TREX
    4343967
SSDB
Motif
Pfam: RSB_motif SAP DUF1344 SAP_new25
Other DBs
NCBI-GeneID: 4343967
NCBI-ProteinID: XP_015644674
UniProt: B9FUB8
LinkDB
Position
7:25931612..25936542
AA seq 906 aa
MSTCPVLNDRPIDEWKVTELKDELRRRDLSIKGLKDDLVKRLAEALQGEVIDGGEETVNG
TPPVENQTQDGALVLDDASGFQASAEQNVDEGPAEVAAKNEGLVSVIEASTEGGTLVLDD
GSGFQASTEQNVDEGPAEVAAKNEGLASVTEASTEDGTLVLADASGIQASTEQNVDEGPS
EVAAKNEGLVSVTEASKDSAIATTEVSQEAVVAAAEVSPEALVAVTEVSEAPLVDVAGTN
ENSLGDAEATKEGDPESVPSDSNVVKEVCSHAEIHCEVIAEKTPDNGSSKKMTVDDISSD
DTSTNTKLEESSAKGEPCVSIGCEILEQETKSSHLDVILSHADAVASAEEMITESLILKK
DSNENDLMYEKDQKDSDHISTDCKPEQSGPKDQVSEVNQDLESQIKCVSISPDDILVNKN
DNVEGNMNADNFDLGLESKQDIVKPSSSNPSSVGDDLQTPDDDKEISLIDMSLQDTDMSL
KKKEGSPDSIYPEKLNLDRSSGDESMEEDAMETKHMDSKTIPDYLEGKSEVTLEHVSSGD
ESMEEDVMETKHVDSNTKVEHVSSGDESMEEDVMETKHVDSNTKPDYLEGKNDVTLEHVV
KEVILLDTVTEGSSVDQKEAISQEKPVMPTEKRKAEDQEVVANNEPIKRQRLWNVDDVKP
EQATSKLSGSDASKVVHPPARRRSFGRSDSTARGNSPKERMVPPPQKPATTSLRIDRFVR
PFTLKAVQELLGKTGSVCSFWMDPIKTHCYVTFSSVEEALATRNAVYNLQWPPNNGSSLV
AEFVDPHEVKAKLEPPPPPPAPINPTAATAPSHQSKANQIMPPHAADTSRGLLPTPPALA
RLPTFNNAPAREMLPPAPKNPEPPVVVTLDDLFRKTQASPRIYYMPVSEEVVSAKLAARG
KGKKAA
NT seq 2721 nt   +upstreamnt  +downstreamnt
atgtcaacgtgtcctgtgctgaatgaccgaccaattgatgagtggaaggttactgaattg
aaggatgagctccgtaggagggatctatctattaaaggtttgaaggatgatcttgtgaag
aggcttgctgaggcccttcagggggaggttattgatggcggggaagaaacagtcaatgga
actccccctgtggagaatcagacacaagacggagctcttgttttagatgatgcatctggt
ttccaggcttcagcagaacaaaatgttgatgaaggccctgctgaggttgctgcaaagaat
gaaggccttgtctctgttatagaagctagtacagagggcggaactcttgttttagatgat
ggatctggtttccaggcttcaacggaacaaaatgttgatgaaggtcctgctgaggttgct
gcaaagaatgaaggccttgcctctgttacagaagctagtacagaggacggaactcttgtt
ttagctgatgcatctggtatccaggcttcaacggaacaaaatgttgatgaaggtccttct
gaggttgctgcaaagaatgaaggccttgtctctgttacagaagctagtaaagatagtgca
attgctactacagaagttagtcaggaagcagttgttgccgctgcagaggttagtccggag
gctctagttgctgttacagaggtcagtgaggcccctctagttgatgtggccggaactaat
gaaaattctctaggtgatgcagaagcaactaaagaaggtgatccagaatctgttccaagt
gacagtaatgtggtgaaggaagtatgttcacatgctgaaattcattgtgaggtcattgca
gagaagactccagacaatggcagcagcaagaaaatgactgttgatgacatatcatctgat
gataccagtactaataccaagttggaggaatcatctgctaaaggtgaaccatgtgtcagt
ataggctgtgagattctagaacaggaaacgaaatcatcacatcttgatgttattttgtca
catgctgacgctgttgcaagtgcagaggaaatgattacagagagcctgattcttaagaaa
gattccaatgagaatgatttaatgtatgagaaggaccaaaaggattctgaccacataagc
actgactgcaaacccgagcagtctggaccaaaggatcaggtatctgaagtcaaccaagat
ctagagtctcaaattaagtgtgtgtcaatttctcctgatgatatactagtcaataaaaac
gacaatgtagaaggcaacatgaacgctgacaattttgatttaggactagagtctaagcag
gatattgtcaagccatcatccagcaatccctcctccgttggtgatgatttgcagacacca
gatgatgacaaagagatatctctgatcgacatgtctctgcaagatactgatatgagcttg
aaaaagaaagaaggcagtcctgatagtatttatcctgaaaaactaaatttggataggagt
tcaggagatgaatcaatggaggaggatgcgatggaaactaagcacatggattccaaaaca
atacctgattatctcgaaggaaagagtgaggtcaccttagagcatgtgagttcaggagat
gaatcaatggaggaggatgtgatggaaactaagcacgtggattccaatacaaaagttgaa
catgtgagttcaggagatgaatcaatggaggaggatgtgatggaaactaagcacgtggat
tccaatacaaaacctgattatctcgaaggaaagaatgatgtcaccttagagcatgtggta
aaagaggtgatcctccttgatactgtcactgagggttcatctgtagatcaaaaggaagct
ataagtcaagagaagccagtaatgccgactgaaaagaggaaagctgaagatcaagaagtt
gttgcaaataatgagccaatcaaacgtcagcgcctatggaatgtggatgatgtcaaacct
gagcaagcaacttccaaactaagtggttctgatgcttctaaagttgtacacccgcctgct
cgaagacgttcttttggcaggtctgattcaacagcacgtggaaattctccgaaggagagg
atggtaccaccgcctcagaaacctgcaacaacttccttgagaatcgatcgatttgtgcgc
ccgttcactttgaaagctgtgcaagagcttcttggtaaaactggatctgtttgtagcttt
tggatggatcctatcaagactcattgctatgtcacattctcttcggtggaggaagctctg
gctaccaggaatgctgtttacaatctccaatggcctccaaacaatggcagttccttagtt
gctgaattcgttgatccacatgaggtgaaggccaaacttgaaccccctcccccacctcca
gcacctatcaaccccacagcagctacagcaccttcccaccaatccaaggccaaccaaatc
atgcctcctcatgctgctgatacatcaagggggctattacccacaccaccagcacttgct
aggcttccaaccttcaacaacgcaccagcgagggagatgcttccgcccgctccaaagaac
ccagaaccacctgtggtggtgactcttgatgatctctttaggaagacacaggcctctccg
aggatctactacatgcctgtttcagaagaggtggtatctgccaagcttgcagcacgcggc
aaagggaagaaggcagcgtag

DBGET integrated database retrieval system