KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333014
Entry
4333014           CDS       T01015                                 
Name
(RefSeq) phospho-2-dehydro-3-deoxyheptonate aldolase 1, chloroplastic
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    4333014
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     4333014
SSDB
Motif
Pfam: DAHP_synth_2
Other DBs
NCBI-GeneID: 4333014
NCBI-ProteinID: XP_015630375
UniProt: Q75LR2 A0A8J8YN91 Q10KC0
LinkDB
Position
3:15603828..15608711
AA seq 555 aa
MSLATSSSMAGGAAVVPRSATATTASAFVTMKRRATAVRAVHAAEPSKNPPVGVPSAAKT
SSPSVAAPEKAPVAAAPAPVAPAPAATKQVAPARWAVDSWRTKKALQLPEYPNAAELEAV
LKTIEAFPPIVFAGEARHLEERLADAAMGRAFLLQGGDCAESFKEFNGNNIRDTFRVLLQ
MSAVLTFGGQMPVIKVGRMAGQFAKPRSEAFEERDGVKLPSYRGDNINGDAFNEKSRIPD
PQRMVRAYAQSAATLNLLRAFATGGYAAMQRVTQWNLDFTQHSEQGDRYRELAHRVDEAL
GFMSAAGLTVDHPLMTSTDFWTSHECLLLPYEQSLTRQDSTTGHFYDCSAHMLWVGERTR
QLDGAHVEFLRGVANPLGIKVSDKMNPTELVKLIEILNPSNKPGRITIITRMGAENMRVK
LPHLIRAVRHAGQIVTWITDPMHGNTIKAPCGLKTRPFDSILAEVRAFFDVHDQEGSHPG
GVHLEMTGQNVTECIGGSRTVTFDDLGDRYHTHCDPRLNASQSLELSFIIAERLRRKRIR
SSKLNNMLPLPPFGV
NT seq 1668 nt   +upstreamnt  +downstreamnt
atgtcgctcgccaccagctcctcgatggccggtggggcggcggtggttccacgcagcgcg
acggcgacgacggcctcggcgttcgtcacgatgaagcggcgcgccacggccgtgcgcgcc
gtacacgcggcggagccgtcgaagaacccgcccgtcggcgtcccgtccgcggcgaagacg
tcgtcgccgtcggtggcggcgccggagaaggcccccgtggcggccgcgcccgcgcctgtg
gctccggctccggcggccacgaagcaggtggcgccggcgaggtgggcggtggacagctgg
aggacgaagaaggcgctgcagctgccggagtaccccaacgcggcggagctggaggcggtg
ctcaagacgatcgaggcgttcccgccgatcgtgttcgccggggaggcgaggcacctggag
gagcgcctcgccgacgccgccatgggccgcgccttcctcctccagggcggcgactgcgcc
gagagcttcaaggagttcaacggcaacaacatccgcgacaccttccgcgtcctcctccag
atgtccgccgtcctcaccttcggcggccaaatgcccgtcatcaaggttgggagaatggcg
gggcaattcgcgaagccgaggtcggaggcgttcgaggagagggacggggtgaagctgccg
agctacaggggcgacaacatcaatggcgacgcgttcaacgagaagagccgcatccctgac
ccgcagaggatggtccgggcctatgcgcagtccgccgccacgctcaacctcctccgcgct
ttcgccaccggaggatacgccgccatgcagcgcgtgacgcagtggaacctcgatttcacc
cagcacagcgagcagggcgacaggtaccgtgaattggcacacagggttgatgaagccctt
ggctttatgtctgctgctgggctaacagtggaccacccgttgatgacaagtactgatttc
tggacctcacatgagtgccttctcctaccctatgaacaatctctgacccgtcaggactcc
acaactggtcatttctacgactgctctgcccacatgctatgggtgggcgaacgcactcgc
cagctcgatggtgctcatgttgagttcctcaggggtgtggccaaccctcttggcatcaag
gtgagtgacaaaatgaacccaaccgagttggtgaagctgattgagattttgaacccatca
aacaagcctgggagaattaccatcatcacaaggatgggggcagagaacatgagggtcaag
ttacctcatcttatccgtgcggtccgccacgctggacaaattgtcacatggattactgat
ccaatgcacgggaacaccatcaaggctccttgtggtctgaagacacgcccctttgactcc
attctggccgaggtacgagcattcttcgatgtgcatgatcaagaaggaagccacccagga
ggtgtccacctcgagatgactgggcagaacgtaaccgagtgcatcggcggatcccgaacc
gtcaccttcgatgacctgggtgaccgctaccacacccactgcgacccgaggctgaacgcg
tcccagtcgctggagctctccttcatcatcgccgagaggctgaggaggaagaggatccgg
tcgtcgaagctgaacaacatgttgccgttgccacccttcggtgtctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343946
Entry
4343946           CDS       T01015                                 
Name
(RefSeq) phospho-2-dehydro-3-deoxyheptonate aldolase 2, chloroplastic
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    4343946
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     4343946
SSDB
Motif
Pfam: DAHP_synth_2
Other DBs
NCBI-GeneID: 4343946
NCBI-ProteinID: XP_015646378
UniProt: Q75W16 A3BMB2 Q0D4J5
LinkDB
Position
7:complement(25726436..25730176)
AA seq 537 aa
MALATNSAAVSGGAAAAASSAPQPRLAATFLPMRRRTVSAVHAADPAKSNGPVQAAAKAS
SPSTVAAPEKKPVGLGKWTVDSWKAKKALQLPEYPSQEELDSVLKTIETFPPVVFAGEAR
HLEERLADAAMGRAFVLQGGDCAESFKEFNANNIRDTFRILLQMGAVLMFGGQMPVVKVG
RMAGQFAKPRSDSFEERDGVKLPSYRGDNINGDTFDEKSRVPDPQRMIRAYAQSVATLNL
LRAFATGGYAAMQRVTQWNLDFMDHSEQGDRYRELAHRVDEALGFMTAAGLTVDHPIMTT
TDFWTSHECLLLPYEQSLTREDSTSGLFYDCSAHMLWVGERTRQLDGAHVEFLRGVANPL
GIKVSDKMNPRDLVKLIEILNPSNKPGRITIITRMGAENMRVKLPHLIRAVRNSGQIVTW
ITDPMHGNTIKAPCGLKTRPFDSILAEVRAFFDVHDQEGSHPGGIHLEMTGQNVTECIGG
SRTVTFDDLSDRYHTHCDPRLNASQSLELAFIIAERLRRRRMRSGVNSNLPLPPLAF
NT seq 1614 nt   +upstreamnt  +downstreamnt
atggcgctcgccaccaactccgccgctgtttccggtggcgctgcggccgcggcgtcgtcg
gcgccccagccgcggctcgccgccacgttcctcccgatgaggaggcgaaccgtctcggcg
gtccacgcggccgacccggcgaagagcaacgggcccgtgcaggccgcggcgaaggcctcg
tccccgtcgacggtggcggcgccggagaagaagccggtggggttggggaagtggacggtg
gatagctggaaggcgaagaaggcgctgcagctgcccgagtacccgagccaggaggagctc
gactccgtgctcaagacgatcgagacgttcccgcccgtggtgttcgccggggaggcgcgc
cacctcgaggagcgcctcgccgacgccgccatgggccgcgccttcgtcctccagggcggc
gactgcgccgagagcttcaaggagttcaacgccaacaacatccgtgacaccttccgcatc
ctgctccagatgggcgccgtcctcatgttcggcggccagatgcccgtcgtcaaggtcggg
aggatggctggccagttcgccaagccgaggtctgattcgttcgaggagagggacggggtt
aagctgccgagttacaggggagacaacatcaatggcgacaccttcgacgagaagagccgc
gtgccggacccgcagcggatgatccgcgcgtacgcgcagtcggtggcaacgctcaacctg
ctccgcgccttcgccacgggagggtacgccgccatgcagcgcgtcacgcagtggaacctc
gatttcatggatcacagcgaacaaggagacaggtaccgtgaattggcacaccgggtggat
gaggcacttggcttcatgactgcagcagggctaacagtcgaccatccgataatgacaaca
actgacttctggacatcccatgagtgcctcctcttaccatatgagcagtctcttacacgt
gaggattccaccagtggcctcttctatgactgctcagcccacatgctatgggttggtgag
cgcactcgccagctcgatggagctcatgttgaatttctccgtggtgttgccaaccctctt
ggcataaaggtgagtgacaaaatgaacccccgtgacttggtgaagctcattgagattttg
aacccatcaaacaagcctggaaggataaccataattacaagaatgggggcagagaacatg
agggtgaaattgcctcatcttatccgtgctgtccgcaactctggacagattgtcacatgg
attactgatcccatgcatggaaacaccatcaaggctccatgtggtctgaagactcgtcca
ttcgattccattctggctgaagtacgtgcgttcttcgatgtccatgatcaagaaggtagc
cacccaggaggtatccacctggaaatgactgggcagaacgtgactgaatgcatcggtgga
tcaaggaccgtcaccttcgatgacctgagcgaccgctaccacacccactgtgacccaagg
ctgaacgcgtcgcaatccctggagctcgccttcatcatcgccgagagactgaggcggagg
aggatgcggtccggggtcaacagcaacctgccattgcccccattggctttctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345872
Entry
4345872           CDS       T01015                                 
Name
(RefSeq) phospho-2-dehydro-3-deoxyheptonate aldolase 1, chloroplastic-like
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    4345872
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     4345872
SSDB
Motif
Pfam: DAHP_synth_2
Other DBs
NCBI-GeneID: 4345872
NCBI-ProteinID: XP_015650153
UniProt: Q6YTT3 Q0J4W9
LinkDB
Position
8:complement(23934870..23938883)
AA seq 505 aa
MPLAPCPSPPLPSSPWPARAPRRGGLLRARAVRAAPRPPSKWSLGSWRSLTALQQPEYPD
KAELDEVLRTVEAFPPIVFAGEARKLEERLAEAAVGRAFLLQGGDCAESFKEFNANNIRD
TFRVLLQMSVVLMFGGQMPIIKVGRMAGQFAKPRSDGFEERDGVKLPSYRGDNINGDSFD
EKSRLPDPHRMIRAYSQSAATLNLLRAFATGGYAAMQRVTQWNLDFTEHSEQGDRYMELA
HRVDEALGFMAAAGLTMDHPIMTTTEFWTSHECLLLPYEQALTREDSTSGLYYDCSAHFL
WVGERTRQLDCAHVEFLRGIANPLGIKVSDKMDPKELVKLIDILNPQNKPGRITIITRMG
PENMRVKLPHLIRAVRGAGQIVTWVTDPMHGNTMKAPCGLKTRSFDRILAEVRAFFDVHE
QEGSHPGGVHLEMTGQNVTECIGGSRTVTFDDLGSRYHTHCDPRLNASQSLELAFIIAER
LRKRRIASWQLNKNSHLGNIPSLGL
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgcccctcgcgccatgcccctcgccgcccctcccctcctccccgtggccggcgcgcgcc
ccgcgccggggcggcctcctccgcgcccgcgcggtgcgggcggcgccccggccgccgagc
aagtggtcgctgggtagctggcgcagcctgacggcgctgcagcagccggagtaccccgac
aaggcggagctggatgaggtgctccggacggtggaggcgttcccgccgattgtcttcgcc
ggcgaggcgcgcaagctggaggagcggctcgcggaggccgccgtcgggcgcgcgttcctc
ctccagggcggcgactgcgccgagagcttcaaggagtttaacgcgaacaacatccgggac
accttccgtgtgctcctccagatgtccgtggtgctcatgtttggaggccagatgcctatc
atcaaggtaggaagaatggcaggtcagtttgcaaagccaaggtcagatggctttgaggag
agggatggagtgaagttgccaagctacagaggggataacattaatggggattcattcgat
gagaaatcaagattgccagatccacaccgcatgatcagggcatactcacagtctgcagca
acactgaatttgctgcgggcttttgctactggaggttatgctgccatgcagagggtaaca
caatggaaccttgacttcacagagcatagtgaacagggtgacaggtacatggagctggct
caccgagttgatgaggctttggggttcatggcagctgctggtctcactatggaccatcct
attatgacaacaacagaattctggacatcacatgagtgccttcttcttccctatgagcaa
gcacttactcgcgaggattccacatctggcctctattacgactgttctgctcacttcctt
tgggttggagagcgtacacgtcagcttgattgtgcccatgtggagtttctccgaggaatt
gcgaaccctctgggtatcaaggtcagtgacaagatggacccaaaagaacttgtgaagttg
attgatatcttgaatccccagaacaaaccagggagaattactatcattacaagaatggga
cctgaaaacatgagagtgaaactccctcacctaatacgtgctgtccgtggtgctggccag
atagtaacatgggttactgatccgatgcatggtaacacaatgaaggctccttgtggcctc
aagactcgctcctttgatagaatcttggctgaggtgcgcgcattctttgatgtgcacgaa
caagaaggcagccacccaggaggggtgcatctggagatgactggacaaaatgtgacagaa
tgcatcggcgggtcacgcacggtgacattcgacgatctgggctcacgataccacacacac
tgcgacccgaggctcaacgcatcgcagtctctggagttggcgttcatcatcgccgagcgg
ctcagaaagaggaggatcgcctcatggcagttgaacaagaacagtcatctgggcaacatc
ccatctttggggctctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349410
Entry
4349410           CDS       T01015                                 
Name
(RefSeq) phospho-2-dehydro-3-deoxyheptonate aldolase 2, chloroplastic
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    4349410
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     4349410
SSDB
Motif
Pfam: DAHP_synth_2
Other DBs
NCBI-GeneID: 4349410
NCBI-ProteinID: XP_015613306
UniProt: Q336R7 Q0IVL7
LinkDB
Position
10:complement(22289794..22293560)
AA seq 508 aa
MTCHSAMAALTVGHAAIVHATTRLEDARSTGRRRRRRGMITVRAAAAATSGWEPGSWRAR
PARQIPEYPDAAALEGAERELASFPPLVFAGEARKLEERLGDAAMGRAFLLQGGDCAESF
KEFAANNIRDTFRLMLQMAVVLTFGGQMPTIKVGRMAGQFAKPRSNPTETIDGVTLPSYR
GDIINSDGFDEKSRAPDPERLIRAYSQSASTLNLLRGFAHGGYADLQRVTQWNLDFLRDS
TQGDRYMELSERVHDAIGFMVAAGLTPQHPIMTTAEFWTSHECLHLPYEQALTRVDSISG
LYYDCSAHMLWVGERTRQLDGAHVEFLRGISNPLGVKVSDKLEPSELVKLCEILNPHNKP
GRLTIITRMGAENTRVKLPHMIRAVRQAGLIVTWVSDPMHGNTISAPCGLKTRSFDAIRC
ELRAFFDVHEQEGSYPGGIHLEMTGQNVTECIGGSKTVTLDDLSSRYRTHCDPRLNASQS
LELAFAIADRLRKKRDRAWNRLVYRAVA
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgacgtgtcactctgccatggcggctctcaccgttgggcacgcggcgatcgtccatgcc
accacgcgtctcgaggacgcccggtccaccggccgtcggcggcggcggcgggggatgatc
acggtgcgcgcggcggcggcggcgacgagcgggtgggagccgggcagctggagggcgcgg
ccggcgaggcaaatcccggagtacccggacgcggcggcgctggagggcgcggagcgcgag
ctggcgtcgttcccgccgctggtgttcgccggggaggcgcggaagctggaggagcggctc
ggggacgccgccatggggcgggccttcctcctgcagggcggcgactgcgccgagagcttc
aaagagttcgccgccaacaacatccgcgacacctttcgcctcatgctccagatggccgtc
gtcctcacctttggcggccagatgcccaccatcaaggttggaaggatggctggccaattt
gcaaagccaagatcaaacccaactgagactatagatggagtgacacttccttcctatcga
ggtgatattattaacagcgatggttttgatgagaagtcgcgtgcaccagatcctgaaagg
ttaattagagcctacagccagtccgcgagcaccctgaatcttctgagaggatttgctcat
ggagggtatgcagatctgcagagagtcacccagtggaatcttgacttcttgagggacagc
acgcaaggggacaggtatatggagctgtccgagagggttcacgatgccatcggatttatg
gttgctgctggtctgactcctcagcatcccatcatgacgacggctgaattctggacatct
catgagtgccttcatttgccatatgagcaagcattgactagggtggactccatttctggg
ctttactacgattgctctgctcatatgctttgggttggggagaggactcgacaactggat
ggtgctcatgttgaattccttcgtggtatttccaaccctctaggtgtaaaggtgagtgac
aagctcgaaccttcagagcttgttaaattgtgtgagattttgaatcctcacaacaagccc
ggaagactgacaatcatcacaagaatgggtgctgagaacacgcgcgttaagctcccacat
atgatcagagcagtccgccaagctgggttgattgtcacttgggtcagtgatcccatgcat
gggaacaccatcagcgcaccatgtggtctcaagacaagatcattcgacgcgatcaggtgc
gagctgagggctttcttcgatgtccatgagcaagagggaagctaccctggagggattcac
ctggagatgacagggcagaacgttacagagtgcattggtggatccaagacggtgaccctt
gatgatctcagctctcgctaccgcacgcactgcgaccccaggctgaatgcatcgcagtcg
cttgaactggctttcgccattgctgacaggctaaggaagaaacgagacagggcttggaat
aggttggtgtacagggcggtagcttaa

DBGET integrated database retrieval system