KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333016
Entry
4333016           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S6
  KO
K02991  small subunit ribosomal protein S6e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4333016
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4333016
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4333016
  Archaea
    4333016
SSDB
Motif
Pfam: Ribosomal_S6e ATG14
Other DBs
NCBI-GeneID: 4333016
NCBI-ProteinID: XP_015630377
UniProt: A3AIN7 Q75LR5
LinkDB
Position
3:complement(15622164..15624595)
AA seq 245 aa
MKFNIANPTTGCQKKLEIDDDQKLRAFYDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG
FPMKQGVLTSGRVRLLLHRGTPCFRGYGRRDGERRRKSVRGCIVSQDLSVINLVIVKKGD
NDLPGLTDTEKPRMRGPKRASKIRKLFNLAKDDDVRKYVNTYRRTFTTKNGKKVSKAPKI
QRLVTPLTLQRKRARIAQKKQRIAKKKSEAAEYQKLLAQRLKEQRERRSESLAKRRSKLS
AATTA
NT seq 738 nt   +upstreamnt  +downstreamnt
atgaagttcaacatcgccaacccgaccaccgggtgccagaagaagctcgagatcgatgac
gaccagaagctccgggcattttatgacaagaggatctcccaggaagtcagtggtgatgct
cttggcgaagaattcaagggctatgtattcaagatcatgggaggctgtgacaagcaaggt
ttccccatgaagcagggtgtgcttacttctggacgtgtccgccttctcctccacaggggt
accccctgcttccgtggatatggcaggcgtgatggtgagcgcagaaggaagtcagtccgt
ggttgcattgtcagccaagatctctctgttatcaacttggtgattgtaaagaagggtgat
aatgaccttcctggcttgactgacactgagaagcccaggatgaggggacccaagagggca
tctaagatcaggaagctgtttaaccttgccaaggatgatgatgtccgcaagtatgtcaac
acttaccgcagaaccttcactaccaagaacggcaagaaggttagcaaggctcctaagatc
cagaggcttgtcactcccctgactcttcagaggaagagggcgagaatcgcccagaagaag
caaagaattgccaagaagaagtccgaggctgccgagtaccagaagctgcttgcccagagg
ctcaaggagcagagggaacgcaggagtgagagcttggcaaagaggaggtccaagctttct
gctgccaccaccgcataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343945
Entry
4343945           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S6
  KO
K02991  small subunit ribosomal protein S6e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4343945
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4343945
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4343945
  Archaea
    4343945
SSDB
Motif
Pfam: Ribosomal_S6e ATG14
Other DBs
NCBI-GeneID: 4343945
NCBI-ProteinID: XP_015646376
UniProt: Q8LH97 A3BMB1
LinkDB
Position
7:25722850..25725396
AA seq 250 aa
MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG
FPMKQGVLTAGRVRLLLHRGTPCFRGYGRRDGERRRKSVRGCIVSQDLSVINLVIVKKGE
NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRTFTTKNGKKVSKAPKI
QRLVTPLTLQRKRARIADKKKRIAKKKSEAAEYQKLLAQRLKEQRERRSESLAKRRSKLS
SAAKAAATTA
NT seq 753 nt   +upstreamnt  +downstreamnt
atgaagttcaacatcgcgaacccgaccaccgggtgccagaagaagctcgagatcgatgac
gaccagaagctgcgtgcattttttgacaagaggatctctcaggaggtcagtggcgatgct
ctgggcgaggaattcaagggctatgtcttcaagatcatggggggttgtgacaagcagggt
ttccctatgaagcagggagtgctcactgctggacgtgtccgccttcttcttcacaggggc
acaccttgcttccgtgggtatggcaggcgtgatggtgagcgcaggaggaagtctgtccgt
ggttgcatcgtcagccaggacctatctgttattaacttggtgattgtcaagaagggtgag
aatgacctgcctggccttactgacactgagaagcccaggatgaggggacccaagagggcc
tccaagatcaggaagctcttcaacctttccaaggatgatgatgtccgcaaatatgtcaac
acctaccgcaggacattcactaccaagaatggcaagaaggtgagcaaggctcctaagatc
cagcgtcttgtgactcccctcaccctccagaggaagcgtgccagaatcgctgacaagaag
aagaggatcgccaagaagaagtcggaggctgctgagtaccagaagcttcttgcccagagg
ctcaaggagcagagggaacgccggagcgagagcttggcaaagaggaggtccaagctttct
tctgctgccaaggctgctgctaccaccgcctaa

DBGET integrated database retrieval system