KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333020
Entry
4333020           CDS       T01015                                 
Name
(RefSeq) uric acid degradation bifunctional protein TTL isoform X1
  KO
K13484  5-hydroxyisourate hydrolase / 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase [EC:3.5.2.17 4.1.1.97]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4333020
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:osa02000]
    4333020
Enzymes [BR:osa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.17  hydroxyisourate hydrolase
     4333020
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.97  2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase
     4333020
Transporters [BR:osa02000]
 Other transporters
  Others
   4333020
SSDB
Motif
Pfam: Transthyretin OHCU_decarbox
Other DBs
NCBI-GeneID: 4333020
NCBI-ProteinID: XP_015630533
UniProt: B9F8T5 Q7XXQ9
LinkDB
Position
3:15648870..15652152
AA seq 334 aa
MATTRGQLPVEDVLRVNGSRRFAAALAAASPFASLADALLAARRIWLNEVDVNGWLEAFA
AHPAIGTTSSSAPKWCKEEQSAALATATDSTAQELADWNARYREKFGFVFMICASGRTAP
EVLAELKRRYENRPIVELEIAAQEELKITELRLAKLFASEPVAPPSSTVGGPTSQSDKAA
DRMRIIGAHLGSHTQHSANKAPEITGSSNRTRPPITTHVLDVARGSPASGIEVHLEMWKD
ASTPPSFNNKDFNGWATLGSSVTNNDGRSGQLMDIVNNVAPGFYRISFNTSKYAPSGFFP
YVSIIFEIKKNQTTEHFHVPLLHSPFSFTTYRGS
NT seq 1005 nt   +upstreamnt  +downstreamnt
atggccacgacgcgggggcagctgcccgtcgaggacgtgctgcgcgtgaacgggagccgg
cgattcgccgccgcgctggccgccgcctcccccttcgcctccctcgccgacgccctcctc
gccgcccgccgcatctggctcaacgaggtggacgtcaacgggtggctggaggccttcgcc
gcgcacccggccatcggcaccacctcctcctccgcccccaagtggtgcaaggaggagcaa
tcagcagcgcttgcaactgccactgattcgaccgcgcaggagttggcagattggaatgcc
aggtatagggagaagtttgggtttgtgttcatgatatgcgcgtctgggaggactgcccct
gaggtcttagcggagcttaagaggcgctatgaaaataggccaattgttgaacttgagatc
gcagcacaggaagaactgaagataactgaactgcgtcttgcaaagctttttgcatcagag
cctgttgcccccccttcttcaacggttggaggtcctactagccaatcggataaagcagca
gaccgcatgcggattattggagcacatcttggatctcacacccagcattctgccaataaa
gctcctgaaattacaggtagctccaaccgaactcgccctccgatcacaacccatgttttg
gatgtcgctcgtggatcgccagcatcaggaattgaagttcacctagagatgtggaaggat
gcatcaacacccccatcattcaacaacaaagatttcaatggatgggcaaccctgggctca
tcggttacgaacaacgatggccgcagcggtcaactgatggacattgtcaataacgtcgct
cctggtttctaccgcataagtttcaacaccagcaagtatgcaccttcagggttcttccct
tatgtgagcatcatatttgagataaaaaagaaccagacgaccgagcatttccatgtccct
ctgttgcattctcctttttcattcaccacttaccgtggcagttaa

DBGET integrated database retrieval system