KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333045
Entry
4333045           CDS       T01015                                 
Name
(RefSeq) pre-mRNA-processing factor 17
  KO
K12816  pre-mRNA-processing factor 17
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4333045
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4333045
Spliceosome [BR:osa03041]
 Complex C
  Other components
   Step II factors
    4333045
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A
Other DBs
NCBI-GeneID: 4333045
NCBI-ProteinID: XP_015632968
UniProt: Q84MU4 Q0DRC2
LinkDB
Position
3:16065875..16069195
AA seq 573 aa
MDLLQSSYTPDDEDDDEQQPLSSPDASPLRLPAKSAAPAVDDTALALSAAAASTSRPLDP
SLHLVPFNPTADQLWAPVLGPQHPHAPISSASGNRNHKLGHVEDAAVLPFLFDEQYNTFH
RFGYAADPSGLHIVGDAQPSAEPDTVYNLAPSEHKRRRLQSKDEEGANQEPLPPEAKNPA
SDEWILRNKQSPWAGKKEAPPAELTEEQRQYAEAHAAKKAEKEARGEGKGEKSDMVAKST
FHGKEERDYQGRSWITPPKDAKASNERCYIPKRCVHEWVGHTKGVSAIRFFPKYGHLLLS
ASMDCKIKIWDVLESRTCMRTYMGHSKAVRDISFSNDGTKFLSAGYDRNIQYWDTETGQV
ISTFSTGKVPYVVKLNPDEDKQHVLLAGMSDKKIVQWDMKSGQITQEYDQHLGAVNTITF
VDNNRRFVTSSDDKSLRVWEFGIPVVIKYISEPHMHSMPSISLHPNSNWLAAQSLDNQIL
IYSTKERFQLNKKKRFAGHIVAGYACQVNFSPDGRFVMSGDGEGSCWFWDWKSCRRFKTL
KCHNGVCIGCEWHPLETSKVATCGWDGVIKYWD
NT seq 1722 nt   +upstreamnt  +downstreamnt
atggatctcctccagtcgtcctacacgccggacgacgaggacgacgacgagcagcagccc
ctctcctcgccggacgcctcgccgctccgcctccccgccaagtcggccgcccccgccgtc
gacgacacggcgctcgcgctctccgccgccgccgcgtccacctcccgcccgctcgacccc
tccctccacctcgtcccctttaaccccaccgccgaccagctctgggcgcccgtcctcggg
ccccagcacccccacgcccccatctcctccgcctccggcaaccgcaaccacaagctcggc
cacgtcgaggacgccgccgtcctccccttcctcttcgacgagcagtacaacaccttccac
cgcttcggctacgccgccgacccctccggcctccacatcgtcggcgacgcccagccctcg
gccgagcccgacaccgtctacaacctcgccccctccgagcacaagcgccgccgcctgcag
tccaaggacgaggagggcgccaaccaggagcccctaccgccggaggccaagaacccggcg
tccgacgagtggatcctccgcaacaagcagagcccctgggccggcaagaaggaggcacca
cccgcggagctcactgaagagcagcgtcagtatgcggaggcgcacgctgccaagaaggcc
gagaaggaggcgcgcggcgaagggaagggcgagaagtctgatatggttgccaagagtact
ttccatgggaaggaggagagggattaccaaggacggtcatggatcacaccgcccaaggat
gccaaggcgagcaacgagcgctgctatattcccaagaggtgtgtgcacgagtgggttggg
cacaccaagggggtctcggcgattaggtttttccccaagtatggacaccttttgctgtct
gcgagtatggattgtaagattaagatctgggatgtgctcgagtcgaggacatgtatgcgg
acgtacatggggcactctaaggcggtcagagatatatcgttttctaatgatgggactaag
ttcttgagtgctgggtatgacaggaatatacagtattgggatactgagaccgggcaggtg
atctcgaccttctctactggcaaggtcccttatgtagtgaagctcaacccggatgaggat
aagcagcatgttctcctcgctgggatgagtgacaagaagattgtgcagtgggatatgaag
tcagggcagataacccaagagtacgaccagcacttgggagcagtcaataccatcactttt
gtagataataataggaggtttgtgacatcaagcgatgacaagtcgcttcgtgtgtgggag
ttcggcatcccagtggtgattaagtatatcagtgaaccacacatgcattcaatgccatca
atatcactgcacccgaattccaactggctggcagcacagagcttggacaatcagatattg
atatacagtaccaaggagaggtttcaacttaacaagaagaagcggtttgcgggtcacatt
gtggcaggttacgcttgtcaagtgaacttctcaccagatgggaggttcgtgatgtcagga
gatggtgaaggtagttgctggttctgggactggaaaagctgcaggagatttaagacgttg
aagtgccacaatggagtttgcattggatgtgagtggcatcccttggagactagcaaggtt
gcaacatgtggatgggatggcgtaattaagtactgggattga

DBGET integrated database retrieval system