KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333051
Entry
4333051           CDS       T01015                                 
Name
(RefSeq) 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B
  KO
K00921  1-phosphatidylinositol-3-phosphate 5-kinase [EC:2.7.1.150]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00562  Inositol phosphate metabolism
osa01100  Metabolic pathways
osa04070  Phosphatidylinositol signaling system
osa04145  Phagosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    4333051
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    4333051
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    4333051
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4333051
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.150  1-phosphatidylinositol-3-phosphate 5-kinase
     4333051
Membrane trafficking [BR:osa04131]
 Endocytosis
  Macropinocytosis
   Kinases
    4333051
 Endosome - Golgi transport
  Others
   Others
    4333051
SSDB
Motif
Pfam: PIP5K Cpn60_TCP1 FYVE
Other DBs
NCBI-GeneID: 4333051
NCBI-ProteinID: XP_015631729
LinkDB
Position
3:complement(16181635..16194042)
AA seq 1816 aa
MDASDKTFADVVKLLTSWLPRRSNPDNVSRDFWMPDHSCRVCYDCDTQFTIFNRRHHCRR
CGRIFCGKCTTNSIPASSGPDRNIDEGDKIRVCNFCFKQWEQERAAANKQMMPLLSPSLS
EASLFSTKSAITINSVSTTAGSYSTGHYQHVARASSISPPKSSQDKVCHDMLDTHVPEKS
MSAVSNKDETSSVHFGYYTNRSDDEEEECSAYCSDRQVQHQQHNDHYYGPDEFDELESSY
NPTISPTVEENVISKEVSSHATDQGFPSTLPVTKMDDEPDPDNSSECGAASSIYALESTD
TNPLDFEKNELFWFPPEPEDEEDEMEVGLFDDDDDDEPVADSEQRRIRSSSSFGSGEFRN
RDRSSEEHKKVMKNVVDGHFRALISQLLQVENISLHEGDETGWLEIVTSVSWEAANFLRP
DTSQGGGMDPGGYVKVKCLACGHRSESTVVKGVVCKKNVAHRRMTSRIEKPRLLLLAGAL
EYQRVTNQLSSIDTLLQQETDHLKMAVAKIVAQKPNLLLVEHTVSRYAQDLLLEKNISLV
LNIKRPLLDRIARCTNAHIVPSIDLLPSQKLGHCELFYVDKYVEHSVNSNNTAKKMPKTM
MFFEGCPKPLGCTVLLKGGSMDELKKIKHVVQYGIFAAYHLALETSFLADEGATLPEIPL
ESPLTVALPDSRSTADSSISTVPGFTFNVSNSRQTTDGFEHPVAGSIRSTDPGGTDVPPV
SNECTTQTRTTFSHSSGTWSANGGSLNSKTVDRIEKATATSATTSGVLMDHSYTYSTLEK
NWYSGDYHEYGSTMSDVKTMTTVLANSNGSCHHGTSEASTNITNFANLKEPFDGSIDLAN
VENVTNSNVVMVQPVPSTAVQNQETNQGHESTSNKEEIMASDHQSILVALSIRCVWKGTI
CERSHMLRIKYYGNFDKPLGRFLRDCLFNQGYQCISCDKPPEAHVHCYTHQQGSLTISVR
KHTEFVLPGERDGKIWMWHRCLKCPWSNGFPPATLRIVMSDAAWGLSLGKFLELSFSNHA
AASRVASCGHSLHRDCLRFYGFGKMVACFRYAPINVHSIHVPPYKLDFSHQPLDWIQKEA
NEVIDRAKVLFDEISRALHQHSDKRAHSGSLNMECGNHIVDLEGILRREKLEFEGCLNKV
IKKETQKIQPDILEINRLRRQLLFHSYLWDQRLISAARSDRSHQEPYNFKPADKEMVQSI
GSIAEQNAIEKPQSEISATEASFKDHKYVECLQESIDGGNSPGVDPCNSCPNHDQQIAIS
ESDLIQRGSKTPLHSSVSINVESVPLESDIVARRTLSEGQFPSLLDVSNALDAKWTGKND
PVPSSAIVPDCVASSEDSEEHVTDTPSYASVFLNKLGDSAEDQSNWLGMPFLQLYRALNK
QWCRSNRFDALNEYTPVHVSFLRTVERQVGPKFLFPIGVNDTVVGIYDDEPTSIISYALA
SHEYHLQLSDELESDTTDNSLSVTDLRGASLTESVDETASELLRSFVSTEDNILYLSGGK
NPSPSDPLAYRKASHIKVNFGDEGPLGQVKYTVICYYAKQFDALRRICCPSERDFVRSLS
RCKKWGARGGKSNVFFAKSLDDRFIIKQVTKTELESFMKFAPEYFGYISESIVTGSPTCI
AKILGIYQVKSLKGGKEMKMDVLVMENLLFERHVTRLYDLKGSTRSRYNPDSNGSNKVLL
DQNLLEAMPTSPIFVGNKAKRLLERAVWNDTAFLASIGVMDYSLLVGVDEKKHELVMGII
DFMRQYTWDKHLETWVKTSGILGGPKNVAPTVISPKQYKMRFRKAMSTYFLVVPDQWSPP
AVVPSKQGAENNQDND
NT seq 5451 nt   +upstreamnt  +downstreamnt
atggatgcctctgataaaacttttgctgatgtagtaaagcttttgacgtcgtggttgcca
cgtcggtcaaacccagacaatgtctctagggacttctggatgcctgatcacagttgcaga
gtctgttatgattgtgacacacagttcaccatattcaaccgcaggcatcactgtcggcgt
tgtggtcgcattttttgtggcaagtgcaccacaaattccatcccagcttcaagtggccct
gacagaaatatcgatgaaggggacaaaattcgtgtctgcaacttttgctttaagcaatgg
gagcaagagagagccgctgctaacaagcagatgatgccattgcttagtccttccttgtct
gaggcaagtctgtttagcaccaagtcagctatcaccataaatagtgttagtacaacagct
ggatcttactctactggacactatcaacatgtggctcgtgcttccagcattagtccaccc
aaaagttcccaagacaaagtgtgtcatgatatgctagacacccatgtgcctgagaaaagt
atgtccgctgtttcaaacaaagatgagacttcttcagttcattttggctattacacaaac
aggagtgatgatgaagaagaagagtgttctgcttactgctctgataggcaggtacaacat
caacagcataatgaccattattatggtccagatgagttcgatgagcttgaatcatcctat
aatccaacaatatctccgacagttgaagaaaatgtaatttctaaagaagtatcctctcat
gcgactgaccaaggattccccagcacattgcctgtcacaaaaatggatgatgaacctgat
cctgacaatagttctgagtgtggggctgcttcgtccatttatgctcttgaaagtactgat
acaaatccattggattttgagaagaatgaacttttttggtttcctcctgaaccagaagat
gaagaagatgagatggaagttggattgtttgatgatgacgatgacgatgagcctgtagct
gatagtgagcagcgtcgcattcgatcatccagtagctttggtagtggtgaattccgaaac
agagatcggtcaagtgaagaacataagaaagtaatgaagaatgttgtcgatgggcatttc
agggctttgatttcacaactgttgcaggtggagaatatttcattacacgagggtgatgaa
acaggttggttggagattgttacttcagtatcatgggaagctgcaaactttctcagacca
gacacaagccaaggtggtggcatggatcctggtggatatgttaaggtcaaatgcttagcg
tgtgggcaccgtagtgaaagcactgttgtaaaaggagtagtctgtaagaagaatgttgca
cataggcgcatgacatccagaatagagaagcctcgtctcctcctactagcaggtgctctt
gagtaccagcgagtcacgaatcagctatcaagcattgacacgttgctccagcaggaaacg
gatcatcttaaaatggcagtcgcgaagattgttgctcaaaagcctaacttgcttttggtt
gaacatacagtttctcgctatgctcaggatttgctactagaaaagaacatatcactcgtt
ttaaatataaagaggccccttttggatcgaatagctcgttgcacaaatgctcatatcgtt
ccttctattgatctcctaccgtctcagaagcttggtcattgtgagttgttttatgtggac
aaatacgttgaacattccgtgaactcaaataatacagcaaagaaaatgccaaagaccatg
atgttttttgaaggatgcccaaagccattaggttgcactgttctgctgaagggtggtagc
atggatgagctaaagaaaataaagcatgtggtacaatatggcatatttgcagcatatcac
ctggccttggaaacatctttccttgcagatgaaggtgctaccctaccagaaattccattg
gaatctccattgactgtagccttgccagatagccggtctactgcagacagctctatttca
acagtgccaggtttcacgtttaatgtttccaacagccggcaaacaactgatggttttgag
caccctgtcgcaggctctattagatcaactgacccaggtggaacagatgttccaccagtg
tccaatgaatgcactactcaaactcgaactaccttctctcattcttctggaacttggtct
gctaacggcggtagtttgaacagcaagacagttgatagaatagagaaggcaactgcaact
tcagctacaacatctggtgtacttatggatcattcatatacatattctactctagagaaa
aattggtattctggtgattatcatgagtatggttcaaccatgtcagatgttaagacaatg
acgacagttttagccaactcaaatggtagttgtcatcatggcacatctgaggccagcacc
aacatcactaattttgctaatctaaaggagccttttgatggttcaattgatttggctaat
gtggaaaatgtcacaaacagcaatgtggtgatggtgcaaccagtgcctagtactgctgta
caaaatcaagaaactaatcaaggacatgagagcacatcaaataaggaagaaattatggct
tctgatcatcagagcatcttagtcgcattatccatacgatgtgtctggaaaggaactatt
tgtgagcgttcacatatgttacgcataaagtattatggtaactttgacaagcctcttgga
aggtttttgcgtgactgcctatttaatcagggttatcagtgcatttcctgcgacaaacca
cctgaagctcatgtccattgctacacacatcagcagggaagtctaacgatatcagttaga
aaacatacagaattcgttttgccaggggaaagggatgggaagatttggatgtggcacaga
tgtctaaagtgcccttggagcaatggatttccaccagcaactctaaggattgtcatgtct
gatgctgcttggggtctgtcacttggtaaatttttggaacttagcttttcaaatcatgca
gctgcaagtagggtagccagttgtggtcactctctccatagggactgccttcggttctat
gggtttggaaaaatggtggcatgcttccgatatgcgccaattaatgttcattctattcat
gtaccgccttataaacttgatttcagtcaccagcctttggattggatacaaaaagaagca
aatgaggttattgaccgtgcaaaggttctctttgatgaaatatcacgggctttacatcag
cactctgacaaaagggctcatagtggttctcttaacatggaatgcggcaatcacattgtt
gaccttgaaggaattcttcgaagggagaagttagaatttgagggatgtctgaataaagtt
atcaaaaaggagacgcagaaaattcaaccagacattcttgagatcaataggttgaggagg
caattactcttccactcttacttgtgggatcaaagactgatatctgctgcaaggtcagat
agaagtcatcaagaaccatataacttcaagccagctgataaagagatggtccagtctata
ggtagtattgctgagcaaaatgccatagaaaagcctcaaagtgaaattagtgcaactgag
gcttcctttaaagatcataaatatgttgagtgccttcaggagagcattgatggcgggaat
agcccaggagttgatccatgtaatagctgtcctaaccatgaccagcaaatagccataagt
gaatctgatttaatccaaaggggcagcaaaacacctctccacagcagcgtcagtattaat
gtggagtctgttccactggaatctgatattgtagctcgacgcaccctttcagaaggacag
tttcccagtttattggatgtttctaatgcgcttgatgcaaaatggacaggtaaaaatgat
cctgtccctagcagtgcgatagtaccagattgtgtggcatcctcagaggattcagaagaa
catgtgactgatacaccttcatatgcctctgtcttcctgaacaagctaggcgatagtgca
gaggaccagtccaactggcttgggatgcctttcttacaactttaccgtgctctaaacaag
cagtggtgtcgctcaaacaggtttgatgctctcaatgaatatactcctgttcatgtttct
tttcttaggacggtggagcgccaggttgggcccaaatttctctttccaattggtgttaat
gacactgttgttgggatttatgatgatgaacctactagcatcatctcctatgcgcttgct
tcccatgaatatcatcttcagctatcagatgaactggaaagcgacacaacagataattca
ctctcagtaactgatttgagaggtgcttcattaactgaatcagtggatgaaactgcttct
gaacttctaagaagttttgtttctacagaggacaatatcctctatttgtcaggaggcaag
aatccatccccttcagatccactcgcatacagaaaagcaagtcacataaaggtgaatttt
ggagatgaaggtcctttaggacaagtgaagtatactgtaatttgttactatgcaaaacaa
tttgatgctttgaggagaatatgctgcccatcagagcgtgattttgtcaggtcacttagt
cgttgcaagaaatggggtgctcgaggaggaaaaagcaatgtattcttcgcaaaatcactc
gacgatagatttataattaagcaggttaccaagaccgaattagagtctttcatgaaattt
gctccagagtattttggatatatttcagagtcaattgtgactggcagtcctacttgtatt
gcgaaaattcttggtatttatcaggttaagagcctgaaaggtggaaaggagatgaagatg
gatgttctagtgatggaaaatcttctgtttgaacgtcatgtgacaagattgtatgattta
aagggatctacaagatcaagatataaccccgactcaaatggtagcaataaagtacttctt
gatcagaacttacttgaagctatgccaacctcccccatttttgttgggaacaaggcaaag
cggctgctagagagagccgtttggaatgatactgcattccttgcttccataggtgtaatg
gattactctttacttgttggtgttgatgagaagaagcatgaacttgtgatgggcatcata
gattttatgaggcaatatacatgggacaaacatctagagacatgggtgaaaacctcagga
atattgggcggaccaaagaatgttgcacctacagtaatatcaccgaagcagtacaagatg
aggttcagaaaagccatgtcgacttactttcttgttgttccagatcagtggtcacctcca
gcagtagtccctagcaagcaaggggctgagaacaaccaagataacgattaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337509
Entry
4337509           CDS       T01015                                 
Name
(RefSeq) 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B
  KO
K00921  1-phosphatidylinositol-3-phosphate 5-kinase [EC:2.7.1.150]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00562  Inositol phosphate metabolism
osa01100  Metabolic pathways
osa04070  Phosphatidylinositol signaling system
osa04145  Phagosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    4337509
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    4337509
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    4337509
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4337509
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.150  1-phosphatidylinositol-3-phosphate 5-kinase
     4337509
Membrane trafficking [BR:osa04131]
 Endocytosis
  Macropinocytosis
   Kinases
    4337509
 Endosome - Golgi transport
  Others
   Others
    4337509
SSDB
Motif
Pfam: PIP5K Cpn60_TCP1 Imm30
Other DBs
NCBI-GeneID: 4337509
NCBI-ProteinID: XP_015636288
UniProt: Q0J8R0 A0A0P0WH20
LinkDB
Position
4:35412887..35418882
AA seq 1381 aa
MNSVVEIMAISYPPEDGRYYCSSVAAGDDSPAAHHTNAHDDWDWDWVPPPPADAAAAAAA
DDDDDDGDPTPAGSPGSRGEDEEEERQRAQMVSAMNGQLNMLASRFLASAGVEEEWLEVV
TALSWEAALLIQTHACTAGNDMDPASHVKIKCVASGRRRQSQVVRGLVFRKNAAHKHMPT
KCHRPTLLLLHGALGLDSHLGFSSFDSMEQDKLILRASISHIIHTCSPNVVMVEKTVSRD
IQELLLHHGVTLLLDMKLHRLQRIARCSGAPLLSFSQLLHDCPNHLKHCDYFHIDKFFED
HNTTTTTSAAALNKPSKTLMFLEGFSNPLGCTILLRGASTQELKKIKQVLHYTIFAAYHL
VVETSFFEDQRVFLNDTNVDGTPQITHQTSIVSNRSLPTDYDVTCTSRGSLLEYHDGDHK
ATVPFTNKPDSYTQDEGTAIHCEAPPSENLLSSVSGSLRRFIDIFRYQNIYLPVTSSQDT
TGHQNEQDTETSQETASDTLTKDHSCEYMDQLNDLQEQVFAKTNQKMSQPDPFGTEKHQQ
NVEQYRAGENINSDTDEADDVMDSQSILILLSSQCVTKQVVCEESHLYRINYYGNFDVSL
GRYLQDILQNQNLSCSSCGEPPDAHMYSYTHRNGNLTINVRRLLPQHHLPGESEGKIWMW
TRCLRCEHERGISKSSRRVLISTEARNLSFGKFLELSFSSHSAARRLSVCGHLVNRDCLR
YFGLGSKVAKFQYSSVEIYTACKPQRTLEFHNPDMREWFEQEGRNVLARGVKLFYEVSSL
IQHMKIFSEVAINCGDSLPVKEVSQLEEMLIEEKAQFVDSLVKAVDESGMSSSSVNEILG
VNCLYQDLLIRLYVWDRRFHQIVECKSGRMANCVGKKEAAEFAGEPAATGESAVPFENGY
IKEMQYSSETLTDENSRREEQHITKVPSFRVLEGTDTQLINPECGDNRETWIWSPLHELR
ESYRHELQAGYLERFELVNNYSPSHLSPLHKQSSAEFIVGPGGNVLCISEDEISSIISRA
LAISEERRHLLLDALMVEGEAAYSRGSESSKMEKSYSSLSEASSASSSWSSIGSSDSDAS
FSSDDLFSSYDSSLLSSLLHPEVSVNGKSSLKGKYSVICVHANQFYTLRKKCCPSELAYI
TSLSRCMKWDAQGGKSKAFFAKTLDDRFIIKQIKKTEFESFIEFAPDYFKHVYHSLDTGS
QTCLAKILGIYQVKQIRHGKEVKLDLMVMENLLFGHKLSRIYDLKGVVFSRHVSDSNDHG
TVYLDQNFVDDMRVSPIYVGGRTKHLLQRAIWNDTAFLTSINVMDYSLLVGVDKEKHEFV
FGIIDYLRQYTWDKQLETWVKTSLVVPKNASPTVISPKEYKKRFRKFMAKYFLTVPDDWS
T
NT seq 4146 nt   +upstreamnt  +downstreamnt
atgaatagtgtagtagagatcatggcgatcagttacccgccggaggatggccggtactac
tgttcttccgttgccgccggcgatgattcacctgcggcccatcatactaacgcccacgac
gactgggactgggactgggtacccccaccccctgctgatgctgctgctgctgctgcggcg
gacgacgacgacgacgatggcgatccgactcctgctggtagtcctggcagcaggggcgaa
gacgaggaggaggagcggcagagggcgcagatggtgagcgccatgaacgggcagctgaac
atgctggccagccggttcctggcatcggcgggcgtggaggaggagtggctggaggtggtg
acggcgctgtcctgggaggcggcgctgctgatccagacccacgcctgcaccgccggcaac
gacatggacccggcctcccacgtgaagatcaagtgcgtggcgtccggaaggcggcggcaa
agccaggtggtgcgggggctggtgttccgcaagaacgcggcgcacaagcacatgcccacc
aagtgccaccgccccaccctcctcctcctccacggcgccctcggcctcgactcccatctc
ggcttctcctccttcgactccatggagcaggacaagctcattctccgagcctccatctcc
cacatcatccacacctgcagccccaacgtcgtcatggtcgagaagaccgtctcccgcgac
attcaggagctcctcctgcaccacggcgtcactctgctgctcgacatgaagctccaccgc
ttgcagagaatcgctcgctgttccggtgctcccttgctctccttctcccagcttctccat
gattgccccaaccacctcaagcactgcgactacttccacatcgacaagttcttcgaggac
cataacaccaccaccactactagtgctgctgccctgaacaagccatctaaaacattgatg
ttcttggaaggcttttccaacccattgggatgcaccatactgctcagaggcgcaagcacc
caagaactgaagaaaatcaagcaagtcttgcactacacaatattcgctgcataccatctg
gttgttgagacatccttctttgaagatcagagggtattcttgaatgatacaaatgttgac
gggacaccacaaatcactcatcagacttccattgtctcaaatcgttcacttcctactgat
tatgatgtcacttgtactagcaggggatcattactggaataccatgatggggatcacaag
gctacagttcctttcacaaataaaccagactcgtacacacaagatgagggtacagccatc
cactgtgaagcacctccatctgaaaacctgctgtcctcagtctccggatcactcagaaga
ttcattgatatattccgttatcagaatatttatttacctgtaacttcttctcaagataca
actggtcatcagaatgaacaagatactgaaaccagccaagaaacggcgtctgatacctta
acaaaggatcattcttgtgagtatatggatcagttaaatgatctccaggaacaagtattc
gccaaaaccaaccaaaaaatgtcacagcctgatcctttcggtactgaaaaacatcagcag
aatgtggaacagtacagggccggcgaaaatataaattcagacacagatgaggctgatgat
gtaatggattctcagagcatactcatcttgttatccagccaatgtgttacgaagcaggtt
gtctgtgaggagagccatctataccgcataaactattatgggaatttcgatgtctcctta
ggacgatatttgcaagacattttgcagaatcagaacctaagctgttcctcatgtggagag
cctccagatgctcacatgtactcttacacccaccgcaatggaaatctaactattaatgtg
aggcgtttgctgcctcagcatcatttgcctggtgaatctgaaggaaaaatttggatgtgg
actagatgtctaagatgtgagcatgagagagggatatccaaatcatctcggagagtgcta
atatcaactgaagcgcgtaatctctcctttggcaagttccttgaactcagtttctcaagc
cactctgctgctagaaggctatcagtttgtgggcatttggtcaacagggactgcttgcga
tattttgggttgggttccaaagttgcaaagttccaatattcatcagttgaaatttacact
gcctgcaaaccgcaacgaacccttgagtttcacaatcccgatatgcgtgagtggttcgag
caagagggaagaaatgttcttgcgagaggagttaagcttttctatgaagtttctagctta
atacagcacatgaagattttctctgaggtggcaattaactgtggagactctcttcctgtc
aaagaagtttcccaacttgaagagatgctaattgaagaaaaagctcagtttgtggattct
ctggtgaaggctgttgatgaaagcgggatgtctagctcctctgtgaatgagattcttggt
gtaaattgtctctaccaggatcttctgattcgactgtacgtgtgggaccgtcgtttccat
caaattgttgagtgtaagtctggaagaatggctaattgtgtcggcaagaaggaagctgct
gaatttgccggtgaaccagctgcaactggtgaaagtgcagtgccctttgagaatggatat
atcaaggaaatgcagtacagcagcgaaaccttaactgatgaaaattcacggcgtgaggag
caacatatcacaaaagtgccttctttcagagtcttggaaggtacagatacgcagttgata
aatcctgaatgtggggataacagggaaacatggatttggagtccattgcacgagttaaga
gagagttacaggcatgaactgcaggccgggtatttggaaagattcgaacttgtcaacaac
tattctccatctcatctatcccccctgcacaaacaatcatctgctgagttcatagttggt
ccaggtggcaatgtgttgtgcatatcagaggatgaaatatccagcataatatcccgcgca
ctggccatatcggaggaacgtcgccatcttttactagatgctctcatggttgaaggtgag
gcagcctacagcagggggagtgagagctctaagatggagaaatcttacagctcattatct
gaagcttcttcggcctcttcgtcgtggtcatctattggatcttcagactcagatgcaagc
ttttcatctgacgacctcttctccagctatgatagctcacttctgtcatccttacttcat
cctgaagtatctgtcaatgggaaatcatctctcaaagggaaatactcggttatttgtgta
catgccaatcagttttacacccttcggaagaaatgctgcccatctgagcttgcatatatc
acttccttgagccggtgcatgaagtgggatgctcaaggtggaaaaagtaaggctttcttt
gcaaaaacattggatgacaggttcatcatcaagcaaataaagaagacagagtttgaatcc
ttcatagaattcgcacccgattactttaagcatgtgtatcattctctcgacactgggagc
caaacttgtcttgccaaaattttaggaatctatcaggttaagcaaatcagacatggcaag
gaagtgaagcttgatctgatggtgatggaaaatcttctcttcggacacaaattgtcaagg
atatatgatctcaaaggtgttgttttctccagacatgtctctgattcgaatgaccatgga
actgtttacttggatcaaaactttgtcgatgatatgcgtgtttcccctatatatgttggt
ggaagaacgaaacatctcttgcagcgggcaatctggaacgacacagcttttctcacttca
attaatgttatggactactcgttactggtgggagtggacaaagaaaagcatgagtttgta
tttggcatcatagattacctaaggcagtatacatgggacaagcaactggagacgtgggtg
aaaacttctttggtagtgccaaagaatgcttcaccaacagtaatctcacccaaagagtac
aagaagaggtttaggaagttcatggccaagtatttcctgacagttccagacgattggagt
acatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340685
Entry
4340685           CDS       T01015                                 
Name
(RefSeq) putative 1-phosphatidylinositol-3-phosphate 5-kinase FAB1C
  KO
K00921  1-phosphatidylinositol-3-phosphate 5-kinase [EC:2.7.1.150]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00562  Inositol phosphate metabolism
osa01100  Metabolic pathways
osa04070  Phosphatidylinositol signaling system
osa04145  Phagosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    4340685
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    4340685
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    4340685
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4340685
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.150  1-phosphatidylinositol-3-phosphate 5-kinase
     4340685
Membrane trafficking [BR:osa04131]
 Endocytosis
  Macropinocytosis
   Kinases
    4340685
 Endosome - Golgi transport
  Others
   Others
    4340685
SSDB
Motif
Pfam: PIP5K Cpn60_TCP1 baeRF_family5
Other DBs
NCBI-GeneID: 4340685
NCBI-ProteinID: XP_015642842
UniProt: B9FSL8
LinkDB
Position
6:complement(8317764..8326093)
AA seq 1609 aa
MGVPVVQKYDSWTADLAMTDCGGGGGGERCDLGFRPINGGRGAAMEQRGDGTDGPSVSPP
ERVPTPSSSRYAGWRRLSSPGPLRCSTRSVGYEDGDDSERYFSPHSEFSQDTSDTDSVST
SISRMYTFRLGTSSPVDSPVRRLGLGDTSPSSRRSCHSPVYPLNSVHGSEDVDYSSFVDS
PVCGDEQQNNTSIPIDFESNRLIWYPPPPQDEGDDFENGFFEYDDDDYDGNDVGDTNTFT
RVNHDHGGEDDSLGIKGKHNIAHKEFLRNALHGHFRALVSQLLQGHGVDPVDVWSDIISS
LAWQAATFVRPDTSKGGSMDPTDYVKVKCVASGNPNDSTFIKGVVCSKNVKHKRMVSKHE
NPRLLLLGGALEHQKASNKLASINSILEQEKEYLKIAVAKIEAQRPHVLLVEKSVPLYAQ
QLLAKDISLVLNVKRSLLERISRCTGAQIASSIENVTSVRLGQCQTFWIERVSESSSPKN
ANKKSAKTLMFFDGCPRRLGCTILLRGTSHEELRRVKLALQFALFAAYHLSLETSYLADE
GATLPKIPSDISALPLENHVDGGNCSSSYCLQDFNDFQIVGQKTSDNGCNMPANCLNDSE
NPLSADKSFLGPNLNQAEYIGVTNGIYPRSPRSSLDKGCVPPSDIIVQTSKSSPMGPRFH
RVESDLDNGWQNTSDEEHAGLAVRDHNENHIEYFPTSDNPQSILVSLSIACPQRGVVCKQ
SQLFRIKFYGNFDKPLGRYFREDLFNQISCCESCKEPAESHVRCYTHRQGSLTISVRNLA
SVRLPGENDGKIWMWHRCLRCKPKDGIPPATQRVVMSDAARGLSFGKFLELSFSNHTTAN
RVASCGHSLQRDCLRFYGYGSMVAVFRYSPVDILSVNLPPAVLDFTYPMAQDWIIKDAAD
VASRKEYFYKEIFDKLDSIENIVSAQNMSMKTGLPKHVIDLKDLIRVEWKKYDVLSRFAS
TENLNTLELAIDILELNRLRRELIVDAHIWDRRLYMMQALTKENCHTVPTDVQCLDKIPE
RFVEKSKVEIPGTHENWENSLEHTQSSSLTVAANSIKPLIRGDQIDTIVTHFGLKTDIKG
EVPPQSAEDYSSSVVPGPSERPNDGILTDELEKTFERSRSSATNLSDRIDLAWTGSSQLA
NDPSKCSIEALPVVPAALVDDPSYQRVIAPIRINSFDSAINFKNRLSPVDGSDGIIRRAY
SQKPPKALERTGRGLSPTFKTELSVPDIMHGEGRLLLQNAGDVVVPIYDDEPSSMIAHAM
TVPDYHKFMLPLLDQQNDLGRFSVGNSLDQDSSSRSSLDVSTWSYGSDQPRTGNNDSKDI
HLTVSFEDDDSISVDKAKFSVTCYFAKQFDAIRRKCCPDELYYIRSLSRCKRWSAQGGKS
NVYFAKTLDDRFVIKQVTRTELDSFEDYAAEYFKYLTESVSSGSPTCLAKVLGLYQVAAR
NLRDGKELKLDVMVMENLFYKKKISRIYDLKGSLRSRYNPDTSGNNKVLLDLNLLETLHT
KPIFLGSKAKRRLERAVWNDTSFLASVDVMDYSLLVGIDEESKELVMGIIDYLRQYTWDK
QLETWVKASGFLGGSRDVLPTIISPDQYKKRFRKAMSRYFLTVPDQWSS
NT seq 4830 nt   +upstreamnt  +downstreamnt
atgggagttcccgtcgtccagaagtacgattcttggactgcggaccttgcgatgacggat
tgcggcggcggcggaggcggcgagcgctgcgacctcggcttccggcctattaacggaggc
cgaggcgctgccatggagcagcgtggtgacggtacggatgggccgtcggtgtccccgccg
gagcgcgtccccacgccgtcttcgtcgaggtacgccgggtggcggcgcctctcgtcacct
ggtcctctccgatgctcgacaaggagtgttggttatgaagatggtgatgactcggagcgg
tatttctctccgcacagtgagttttctcaggacacttcggatacagattcggtgagcaca
agtattagtaggatgtacaccttcagattggggacttcgagcccggtagatagtcccgtg
agacgattgggactaggagacacaagtccatcctccaggaggagctgccactctcctgtc
taccctttgaattctgtccatggctctgaagatgtcgattattctagctttgtggattca
cctgtttgcggtgatgaacagcagaacaatacctcgataccgattgattttgagagtaac
agactcatttggtatccaccaccacctcaggacgagggtgatgactttgaaaatggtttt
tttgaatacgatgatgatgattatgatggcaatgatgttggtgatacgaataccttcaca
cgtgttaaccatgatcatggtggtgaagatgattcgctgggaataaaaggaaaacacaat
atagcccataaagagttcctaaggaatgctttgcatgggcatttcagggctcttgtgtcc
cagctgctccaaggtcatggcgttgatcctgtggatgtatggtcagacataatatcctca
ttagcatggcaggcggctacctttgtaaggccagatacaagtaaaggtggtagcatggat
cccacggactatgtcaaagtcaaatgtgtagcatcagggaatcccaatgatagtactttc
attaaaggtgtagtttgttctaagaatgtaaaacataaacgcatggtgtcaaagcatgag
aaccctagattgcttcttttggggggagcactggaacaccaaaaggcttcgaacaaacta
gcatcgataaacagcattcttgaacaggaaaaggaataccttaagattgcagttgcaaaa
atagaggcccaacgacctcatgttttgctcgttgaaaaaagcgtgccactatatgctcaa
cagcttcttgcaaaagatatctctttagttctgaatgtcaagagatcacttctagaaagg
atatcacgctgcacaggtgctcaaattgcttcatccattgaaaatgttacttcggtaagg
cttggacagtgccaaacattctggattgaacgagtttcagagtcttcatcaccaaagaat
gcaaacaagaagtctgccaagacactgatgttttttgatggttgtccaagacggttgggc
tgcacgatccttctaagaggcacatcccacgaagagttaaggagggttaaacttgctcta
cagtttgcactatttgcagcctatcacctatcacttgagacctcatatcttgcagatgag
ggtgcaacactaccaaagatcccttcagatatttcagctcttccacttgagaatcatgtg
gatggtgggaactgttcctcaagttactgtcttcaggattttaacgattttcaaattgtt
ggtcagaaaacttcagataatgggtgcaacatgcctgcaaattgccttaatgattctgaa
aacccgctatctgcggataaatcttttctgggacctaacttaaatcaggcagagtacatc
ggtgtcactaatggtatatatcctcgttctccaagatcctcccttgataagggttgtgta
ccaccttcagacattattgttcagacatccaaaagctcaccaatgggaccacgttttcat
agagttgaaagtgacttggataatggttggcaaaatacatcagatgaagaacatgcagga
ttagctgtacgtgaccataatgaaaaccacattgaatatttcccaacatctgataatcca
caaagcattttagtgtccttgtcaatcgcatgtcctcagagaggggttgtatgcaagcaa
tcgcagctctttcgcataaagttctacggtaattttgataagccactcggtagatatttc
cgcgaagatttatttaatcagatttcgtgctgtgaatcttgcaaggaacctgcagaatct
catgttcgatgctacacccatcgacaaggcagtctcacaatcagtgttagaaatcttgcc
tctgtaaggttacctggggagaatgatgggaagatatggatgtggcacaggtgcctcagg
tgcaaacctaaagatggaatccctccagcaacacaaagagtagtgatgtctgatgcggca
cgtggactttcttttgggaagtttttggaacttagcttttcgaatcacacaacggccaac
cgggttgcctcctgtggacattcccttcagagggactgccttcgtttttatgggtatgga
agcatggttgctgtcttccgctattctcctgtggatattctttccgtgaacttgccaccc
gcagtactggacttcacttatccaatggctcaagattggatcatcaaagatgctgctgat
gtagccagcaggaaggagtacttttacaaggagatattcgacaaacttgactcaattgaa
aacatagtttcagcccaaaacatgagcatgaaaacaggcttgcctaaacatgttattgat
cttaaggatttgattagagttgaatggaagaagtatgatgtattgtcaaggtttgctagc
acagaaaacctgaatacacttgaactggctatagatattcttgagctcaatcgcctgagg
agagagcttatagttgatgcacatatatgggatcgtagactgtacatgatgcaggcactt
accaaggaaaactgtcatactgtgccaactgacgtgcagtgtcttgataagattcctgaa
cgttttgtagaaaaatcaaaggttgagattcctggtacacatgagaattgggagaattca
ctagaacatactcagtcaagttcattgacggtggctgcaaatagtataaaaccattgatc
aggggagaccaaattgacacaattgtgacacattttgggttgaaaaccgacattaaaggt
gaagtacctccgcagtctgctgaagactattccagttcagttgttccaggcccatctgaa
cgaccgaatgatgggatactgactgatgagcttgaaaaaacatttgagagatcacgatct
tctgcaaccaacctttctgatagaattgacttagcatggaccggctctagtcagcttgct
aatgacccatcaaagtgtagcattgaggcacttccagttgtacctgctgctctggtggat
gatccctcataccagagagttattgcaccaatcagaatcaattcatttgattctgccatc
aatttcaaaaataggttatcacctgtagatggctcagacggaatcattagaagagcttat
tctcaaaagcctccaaaagctcttgagagaacaggcaggggtttgtccccgacattcaaa
actgagctatcagttcctgatataatgcatggtgaaggtcgtttgcttcttcaaaatgct
ggagatgttgttgttccaatttacgatgatgagccatccagcatgatagcccatgccatg
actgttcctgattatcataaattcatgttgccgttgctggaccagcaaaatgacttgggc
agatttagtgttggaaattctttggatcaggattcctcttctaggagttcattagatgta
tccacgtggagctatggttctgaccaacctcgaactggaaataatgactccaaggatatt
catttgacagtttcttttgaggatgacgattcaatttctgtggataaagctaaattttct
gtaacatgttattttgcaaagcaatttgatgcaatcagaagaaagtgctgtccagacgag
ctttactacattcgttctttgagtcgatgcaagagatggagtgctcaaggtggcaagagt
aatgtatacttcgccaaaacactagatgacagatttgtcataaagcaagtgacccgaacg
gaactagattcatttgaggactatgcagctgagtacttcaaatatttaacagaatctgta
tcttcaggaagccccacgtgccttgctaaagttcttggtctttaccaggttgctgccagg
aacttgagagatggcaaggaactaaagttggatgtaatggtcatggaaaatcttttttac
aagaagaagatatcaagaatatatgacctgaaaggctctttgcgttcccgttacaatcct
gatacatcaggaaacaacaaagttctcttagatctgaatctattagagacacttcataca
aagcccatttttctcggaagcaaagcaaaacgaaggttggagcgagctgtctggaatgat
acttcttttctggcgtcggtggatgtgatggattactcactattagttggcattgatgaa
gaaagcaaagagcttgtgatgggaatcatcgactaccttcgtcagtacacctgggacaag
cagctggagacctgggtgaaggcgtcagggttcctgggtggctccagagacgtgctccca
actatcatttccccagaccagtacaagaagaggttcaggaaggccatgtcgaggtacttc
ctgactgtccctgaccaatggtcatcttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344440
Entry
4344440           CDS       T01015                                 
Name
(RefSeq) 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B
  KO
K00921  1-phosphatidylinositol-3-phosphate 5-kinase [EC:2.7.1.150]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00562  Inositol phosphate metabolism
osa01100  Metabolic pathways
osa04070  Phosphatidylinositol signaling system
osa04145  Phagosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    4344440
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    4344440
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    4344440
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4344440
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.150  1-phosphatidylinositol-3-phosphate 5-kinase
     4344440
Membrane trafficking [BR:osa04131]
 Endocytosis
  Macropinocytosis
   Kinases
    4344440
 Endosome - Golgi transport
  Others
   Others
    4344440
SSDB
Motif
Pfam: PIP5K Cpn60_TCP1 Imm30
Other DBs
NCBI-GeneID: 4344440
NCBI-ProteinID: XP_015650089
UniProt: Q0J8M1
LinkDB
Position
8:250569..258760
AA seq 1610 aa
MSCAQQDMDPPTRDALSEALDGNRSDHSVYDAEHSGQNGIGDTKKRTSSSDLSTDDNFSS
SALQSKHEHMNRDALSIDDRSVKSGDESDGAESTSGKSGSIDSTCTENDSIWIPPEAADK
EYEADSVSGKIAYADDDDDYSDGIKWGRSSFPATNEEQEVSHNTRDERESAMLDAMNGQL
KILVSRFLASAGISFSKGESGESWLDILTSLSWEAALLIKPDASKGKEMDPGSYIKVKCI
ASGTRRQSEVIKGLVFKKNAAHKHMPTSCHNPRLLLLKGVLGHSDVGLSSFNSMDQEKDH
LERAISKMMEICSPNVILVEKTVSRDIQELLLKEGVTLIFDMKLNRLERIARCTGSPIIS
FSEVLDKPKLKRCDSFHIEKFIEEHNSASDGGKRLSKTLMFLEGFPKPLGCTILLRGANS
EELKKVKQVMHYTVFAAYHLILETSFFEDQRIFLNDQNASRENSVTAMAGPSANGYDPSV
LCASDFPSRDDSPALRLYHATSNGYTDVKKSLSSSTKVDAPSSITNSSSSVGEDASIRYD
SKPPLHSQRLPSPVPGTLRKYVGMLSHQNIYLPVTSLQETSATQIEGEVESGKEIVSNGF
HVGSKVEEPAVSTANVDCSQDHQRQERIQDIMPTNSTHDKREESPVMVEDGEQHSTIDII
SKEKTTNEDQADDALDTHSILILMSSQCITKQVICEQSHLSRIKYYGNFDVSLGRYLQDI
LQNPVLQNQKLSCSSCGEFPESHLYSYTHRNGNLTVRVKHLAPQHHLPGESEGKIWMWTR
CLRCENEHGMSKSTPRVLISSEARSLSFGKFLELSFSSHSAARRLSICGHLVNRDCLRFF
GLGSKVAMFRYSSVEIYTTCKPQTTLQFDNPCRQDWFKEERRYVLARGIKLFSEVASMLQ
PLKDQLLDVTTTNCTGSLPVKDFSELEELLIKEKAFFEDSLEKTINQNENLSASVHELVD
INWSYQDLLLELYLWDRRLDQLTKCVSAGQERVVSCKDPFDTVVKNIRVNQEIENKADEL
TCDRTTSVLSAVGLTECPSNRNYIDHQSVDIEAPVLTENQGAGCAQFSSTGGRNDEDSYT
APCQLEVDSMAQTKEVPSFEISEVQGDGIVVHPISLDQEPSNAPNHFRKIPDWDTGEGWI
WNSFHECQLAYRKDIQNEILDKFEIVNRYSPSHMSPLFEQHEEVSSPQFTVGPGGNILSV
LEDEISSIIARALAVSGEHRHLVENETEGARLEHAKTMEKSYSFMSGSSLDSSPWSSIGS
LDSEASFLSLGSSVSSDDLSGYDSLPLFSSIHPEVAVNGKVALRGKYSVTSIYAKQFQDL
RKKCCPSELAYITSLSRCKKWDAQGGKSKAFFAKTVDDRFIIKQIKKTEFESFIKFAPDY
FKHVYHSLDTGSQTCLAKILGIYQVKQTRHGKEIKIDLLVMENLLFGHNISRIYDLKGAI
FSRHVAHSNDRNTVYLDQNYVEDMRVSPIYIGGRTKHLLQRAIWNDTSFLTSVNVMDYSL
LVGVDKEKHELVFGIIDYLRQYTWDKQLETWVKSSLVVPKNVSPTVVSPKEYKKRFRKFM
AKHFLTVPDTWSSENSSGPSKSFGHSNNMLVEVHSDDNLLQHPIEAETVV
NT seq 4833 nt   +upstreamnt  +downstreamnt
atgtcatgtgcccagcaagacatggatccaccaacaagggacgctttgtctgaggcttta
gatggtaatcgcagcgatcacagcgtgtatgatgcagagcattctggacagaacggaatt
ggggataccaaaaagcgtacaagcagcagcgatctatccacagatgacaatttctcctct
agtgctttgcagagcaaacatgaacatatgaaccgtgatgctctttctatagatgaccgc
tcggttaagtctggtgatgaatccgatggggctgagagtaccagtggcaaaagtggcagt
attgactcaacatgcactgaaaatgatagcatctggataccacctgaagctgcagacaag
gaatatgaggctgacagtgtttctggaaagattgcttacgctgacgacgacgatgattac
agtgatgggatcaagtggggccggtcaagtttcccagccactaatgaggagcaggaggtc
agccacaatactagggatgagcgagaaagcgcgatgctagatgccatgaatgggcagtta
aagatacttgtaagtcggttcctggcctctgctggtatctccttttccaaaggagagagc
ggtgagagttggcttgatatccttacctccctatcgtgggaagctgcactactgatcaaa
ccagatgctagcaagggaaaggaaatggaccctggatcttacatcaaggtcaagtgcata
gcatctggtactcgtcggcaaagtgaggtgatcaaggggttagtcttcaagaaaaatgct
gctcacaagcacatgccgaccagttgccacaatcctagactgctgcttctcaaaggagtc
cttgggcattctgatgttggtttgtcatcattcaattcaatggatcaggaaaaagaccat
ctggagagggctattagtaaaatgatggaaatatgtagtcctaatgttattttggttgag
aaaactgtttcacgggatatacaagaacttcttctgaaagaaggtgttactctaattttc
gatatgaagctcaatcggttggaaagaattgctcgctgtacgggttctcccataatctca
ttctcagaagtcttggataaaccaaagctgaaacgttgtgactcgttccacatagaaaaa
tttattgaggagcataacagtgccagtgatggtggaaaaaggctatcgaaaacattaatg
ttcttggaaggcttccccaaaccgttgggttgtacgatattgctaaggggtgcaaatagt
gaagaactgaaaaaagtcaagcaagtcatgcactacacagtatttgcagcgtaccacttg
attcttgaaacatcattctttgaagatcagaggatatttttgaatgatcaaaatgcttca
agagagaattctgttactgccatggcagggccatcagcaaatggttacgatccatctgtt
ctttgtgcctctgactttccttcacgagatgactctccagcacttagactgtaccatgcc
acttctaatggctacactgatgtgaagaaatccctcagttcatcaacaaaagtagatgct
ccaagttcaataacaaacagctcctcgagtgttggagaagatgcaagtatccgatacgac
tcaaagccaccacttcattctcaaaggttaccatcaccagtcccaggaacgctaaggaaa
tacgttggcatgttatctcatcagaatatttatttacctgtcacatccttgcaagaaaca
tctgctacccagatagaaggcgaggttgaatctggtaaagaaattgtcagtaatggtttt
catgttgggtcaaaggtggaagagcctgcagtttctactgcaaatgtggattgctcacaa
gatcaccagagacaagaaagaattcaagatataatgccaacaaattctacgcacgacaaa
cgtgaagaatcacctgttatggtagaagatggggaacaacatagcaccattgatatcatt
agcaaagagaaaactactaacgaagatcaagcggatgatgcccttgatactcacagcata
ttaattttgatgtccagtcaatgcataacaaagcaggttatttgtgagcagagccatctt
tctcgtataaaatattatgggaatttcgatgtgtccttagggcgatatttgcaagacatt
ttgcagaatccggttttgcagaatcagaaactgagctgctcttcatgtggagagtttcca
gagtctcatctgtactcttacactcatcggaatgggaatttgaccgttcgagtcaagcat
ttggcgcctcaacatcatttgcctggtgaatctgaagggaaaatatggatgtggaccaga
tgcttgagatgtgagaatgaacatgggatgtccaaatcgactccaagagtgctcatatca
tctgaagcacgaagtctctcttttggaaaattcctagaactcagtttttcaagccattct
gcggcaagaaggctttcaatatgcggacatttggtgaacagggactgcttgcgctttttt
gggttgggctcgaaagttgcaatgttccggtactcatcagttgaaatttatacaacctgc
aaaccacaaaccactctccagtttgataatccctgcaggcaggattggtttaaagaagag
aggagatatgttcttgctagaggtataaagcttttttctgaggttgcaagcatgctacaa
cccttaaaggatcagcttcttgatgtgacaacaaccaattgcaccggctctctccctgtt
aaagacttctctgaacttgaagagttgttgatcaaagaaaaggccttttttgaggattct
ctagaaaagacaattaatcagaatgagaatctatctgcatctgtgcatgaacttgttgat
atcaattggtcctaccaggatcttctacttgaactttatttgtgggaccgtcgactggat
caacttactaagtgtgtttcagctggacaagagcgtgttgttagttgcaaagatcctttt
gatactgttgtcaagaatattagggtaaatcaggagattgaaaataaagctgacgaattg
acatgtgatagaactacatcagttttgagcgcagttggtttgactgagtgtccaagtaat
agaaattacattgaccaccaatcagttgacattgaagcacccgtgcttactgaaaatcag
ggggctgggtgtgctcaattttcttccactggaggtagaaatgatgaagactcttacact
gctccttgtcaactagaggtagatagcatggcacaaaccaaagaagttccttcatttgaa
atttcagaggttcagggtgatgggatagttgttcatccaatttctttggaccaggagcct
tcaaacgctcccaatcatttcagaaaaattccagactgggatacaggggaagggtggatt
tggaattctttccatgaatgtcaattggcttacagaaaggacatacaaaatgaaattttg
gataaatttgaaattgtcaaccgttattctccgtctcatatgtctcccttgtttgagcaa
catgaagaagtgagctctccacagttcactgttggtccaggtggtaatattttatctgta
ctggaggatgagatatctagtataatagcccgtgctcttgctgtatctggggaacaccgc
catttagtggagaatgaaacagagggtgccaggttggagcatgctaaaacaatggaaaaa
tcatatagctttatgtctggaagttctcttgactcatcaccatggtcatctatcggatct
ttagattccgaagcaagttttttgtctcttggttcatcagtttcatcagatgacctatct
ggttatgatagcttgcctttgttctcttcaatacatccagaagtcgctgtaaatggaaaa
gtagctctcagaggcaaatattctgttactagcatatatgctaaacaattccaagatctt
cgaaagaagtgctgcccatctgagcttgcatatattacttccctaagtcgctgcaagaag
tgggatgctcagggtggaaaaagtaaagctttctttgcaaagacagtggatgacaggttc
atcataaagcaaataaagaagacagagtttgagtccttcataaaatttgcccctgattac
ttcaagcatgtttaccattctctagacactggaagccaaacttgccttgccaaaatattg
ggaatttatcaggttaagcaaacaaggcatggaaaagagataaagatcgatctgttggtg
atggaaaaccttctcttcgggcacaatatttcacggatttatgatcttaaaggtgctatc
ttttcacgacacgttgcacactccaatgaccgtaatactgtttacttggatcaaaactac
gtcgaggacatgcgtgtttctccgatttatattggtggaagaacaaagcatcttttgcaa
cgtgcaatctggaacgacacatcattcctcacttcggtcaacgttatggactattctctg
cttgtgggagtggacaaagaaaagcatgagcttgtatttggcatcattgattatctgagg
cagtacacttgggacaagcagctggaaacatgggtgaaaagttccctagtagtgccaaag
aatgtttcaccaactgtagtttcacccaaggagtacaagaaaaggttccggaagttcatg
gcgaagcacttcctcacagttccagatacatggagttcagagaattcttccggaccaagc
aaatcgtttgggcatagcaataacatgttggtagaagtccatagtgatgacaatctgctt
cagcatccaattgaggctgagacagttgtataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345628
Entry
4345628           CDS       T01015                                 
Name
(RefSeq) putative 1-phosphatidylinositol-3-phosphate 5-kinase FAB1C
  KO
K00921  1-phosphatidylinositol-3-phosphate 5-kinase [EC:2.7.1.150]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00562  Inositol phosphate metabolism
osa01100  Metabolic pathways
osa04070  Phosphatidylinositol signaling system
osa04145  Phagosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    4345628
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    4345628
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    4345628
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4345628
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.150  1-phosphatidylinositol-3-phosphate 5-kinase
     4345628
Membrane trafficking [BR:osa04131]
 Endocytosis
  Macropinocytosis
   Kinases
    4345628
 Endosome - Golgi transport
  Others
   Others
    4345628
SSDB
Motif
Pfam: PIP5K Cpn60_TCP1
Other DBs
NCBI-GeneID: 4345628
NCBI-ProteinID: XP_015650196
UniProt: A0A0P0XG19 Q8H3L8
LinkDB
Position
8:complement(20666138..20673557)
AA seq 1630 aa
MGVVEFSVLGAVQKFRSLIAGPTPPAAAAEGEEVARQTSGPPSPATPTRSRSGAADTTPP
LPARPGGGRRAIALRRQISSPQLLRCHAVRRGDGEDDDEPGVQFFTPGNDYLHDFSDTDS
LSVSTPNGVARSLTPSPLESPTWMVGHNDASPTSKRNERLSLDSLGCDTRLNGGIADRSG
GDMTRYPADFDANVWLPPSPEDEGDDVEARLFGFDYEDDEAGDSGKLLALGNFNTNKIVG
VDTITDIAHKEGLRNAVLGHFRALVAQLLKGECIDLENDNGSKSWLEIVSSLAWLAAGYV
RPDTKKGGSMDPTDYVKVKCLASGDPSDSNLVRGVVCSKNVKHKRMASEHVNAKLLILGG
ALEYQKVTNKLASIDTILEQEKEHLRAIVAKIESRRPNVLLVEKSVSSYAQELLAKDISL
VLNVKRPLLDRISRCSGAQIASSIDNIASARLGQCELFKVHKVSEFSSGKQTNRRSMKTL
MFFEGCPRRLGCTVLLRGSCREELKKIKRVVQLAVFAAYHLSLETSFFADEGATLPKVPS
RPMVVVNDIRSDPSNYFAGSAGVGIPHGLKPVQGKHSEATRVNGMFKENSISPGSLSLNE
EGEGVISEHRESKIPVEHMNCHDHDSFHATESCKGHKIFPCSLDHDIRTSDMVMQYQYLN
DSTQLPINDDRQGMVSGKKFQEVDHYGPKPHDDYLMGDADGPNELSGEYFPATDNHQSIL
VSLSSTCIPKSMLCERSQLFRIKFYGSFDKPLGRYLREDLFDQAYCCPSCKESSESHVRC
YTHQHGSLTISVRRLLSQKLPGERDGRIWMWHRCLKCEPKDGVPPATRRVIMSDAAWGLS
FGKFLELSFSNHTTANRVASCGHSLQRDCLRFYGYGNMVAFFRYSPVDILSVNLPPSVLD
FNCRSRQDWMRRMAVEIYSKMETLHSEVYDFLHHNENSVTSEDEPVKAGVQRQIIEMKDL
LKMERNGYEILLLPVITDSNHSVQVSIDVLELNRLRRGLLLDAYIWDRRLCYIDSLLKKD
SHVSNPDIFLDVRLKEWKADLLVGDTKIGKSTNLSQSSGSPRKSLLSREGCLNDTEYRMG
ETNSQIDLVTHPVDDAEDLDKVFRRFNGETEQPVTTATMGKEPVERLPSLASIFSDKIDL
AWTGSSEIQDDLLQGFTKIDEYGSFNFPDNPSYGNSVTPVRIHSFDSKFAIHQRERNGLA
PTSLHLSSFRSAEYFGDFTSILKDPMPNIRRACSQRSPGAVEKLNVVLTRTLTYISSASH
MIDDGARLLLPQIGYEDDAVIAVYDDEPTSIVSYAMTSQEYVQQVTRKLNSSLSFLHLPN
AIDSSHGLDGTLLSQEDHLDSKGTHFKFSFDDESPLSEDKAKFSITCYFAKHFAALRKKC
CPKDIDFIRSLSRCKRWNAQGGKSNVYFAKTLDERFIIKQVTRTELESFVEFAPQYFRYL
MESLTSGSPTCLAKIVGVYQVNIKGLKGGREVKMDLMVMENLFFERKISRVYDLKGSLRS
RYTSSESKVLLDSNLLEALHTKPIFLGSKAKRRLERAVWNDTSFLATADVMDYSLLVGID
EEKKELVIGIIDYLRQYTWDKQLETWVKASGILGGPKNESPTVISPMQYKKRFRKAMSKY
FLTVPDQWSS
NT seq 4893 nt   +upstreamnt  +downstreamnt
atgggagtggtggagttctcggtgctgggggcggtgcagaagttcagatccctcatcgcc
ggccccacgccccccgccgccgccgccgaaggcgaggaggtggcccggcagacgagcggc
ccgccgtcgcccgcgaccccgacgagatcgcgcagcggcgccgcggacacgacgccgccg
ctccccgcgaggcccgggggcggcaggcgcgccatcgccctgcgccgccagatctcctcg
ccgcagctgctccgctgccacgctgtcaggcgaggcgatggagaggacgacgatgagccc
ggggtacagtttttcaccccagggaatgactacttacatgacttttcagatacagactct
cttagcgtcagtactcctaacggggtcgccaggtccttgacaccaagccctctggagagc
ccgacttggatggtggggcacaacgacgcctcgccaacgtccaagaggaacgagcgcctc
agcctggattctcttggttgcgataccaggctgaacggtggcatcgcagacaggagtgga
ggtgacatgacccgttatcctgctgatttcgatgccaatgtctggctcccgccatcaccg
gaagatgagggtgacgatgttgaagcgagattatttggattcgactacgaggatgatgag
gctggggactcgggcaagcttcttgctcttggtaactttaatactaacaaaatagttggt
gttgacacaatcacagacatagctcacaaagagggtctgaggaatgctgtacttgggcat
ttccgggctcttgtggctcaattgcttaagggagaatgtattgatctggaaaatgacaat
ggatccaaaagctggcttgaaatagtatcctccctagcttggctagctgctggctatgtg
agaccagataccaagaaaggtggcagcatggatcctactgattatgtgaaagttaaatgt
ttagcatcaggggatccaagtgatagcaatcttgttagaggagtggtttgctctaagaat
gtaaaacacaaacgcatggcctctgagcatgtgaatgcaaaattgctcattttaggggga
gcacttgagtatcagaaggtcacgaacaaactagcatccattgatactatacttgaacag
gaaaaggagcacctgagggcaattgttgcaaagattgagtctcggcgaccaaatgtgctg
ctagttgagaaaagtgtctcatcttatgcccaggaactcttggcaaaagatatttcttta
gttctgaatgttaagagaccgcttttggataggatatcaagatgctcaggagcacaaatt
gcctcgtcaattgacaatattgcttcagcaagactaggtcaatgtgaattgttcaaggtg
cataaagtttcagaattctcatcaggaaaacagacaaacaggaggtcaatgaagaccctg
atgttctttgaaggctgtccgaggcgtttaggttgcacggttctactgagaggatcatgt
cgagaggaactaaagaaaattaagcgtgttgtgcaacttgctgtgtttgcagcttatcac
ctctctcttgaaacatcattctttgctgatgaaggtgcgactcttcccaaggttccttca
aggccaatggtagtggtaaatgatattcgaagtgacccaagtaactattttgctggatct
gctggtgttggtattcctcatggacttaaacctgtacaaggcaaacattcagaagctact
agagtcaatggtatgtttaaggaaaattctatatcacctggctcattatcgttgaatgag
gaaggagagggggtcatctctgagcatagggaatctaaaattcctgttgaacatatgaat
tgtcatgatcatgattcattccatgcaactgaatcatgcaaaggtcataaaatatttcca
tgttcattggatcatgacattagaacttcagatatggtgatgcaatatcagtatttgaat
gactcgacacaacttcccataaatgatgaccgtcaaggcatggtttcaggaaagaaattt
caagaggtagaccactatggtcccaaaccacatgatgattatttgatgggagatgcagat
ggcccgaatgagctttctggtgaatattttcctgctactgacaaccatcagagcatctta
gtttccctttcaagcacttgtatccccaaaagcatgctatgcgagcgttctcagctcttc
cgcatcaagttttatggtagctttgataagccacttgggaggtacctcagggaagactta
tttgatcaggcatattgctgcccgtcatgcaaagagtcatcagaatcacatgtcaggtgc
tatactcatcagcatgggagtttaacaattagtgttcggcggcttctgtctcaaaagtta
ccaggtgaacgtgatggtaggatatggatgtggcatagatgcctcaagtgcgaacctaag
gatggtgtaccacctgccacacggagggtaattatgtcagatgcagcttggggtctgtcg
tttgggaagttcttggagctaagcttttcaaaccatactactgctaaccgagttgcaagt
tgtggacattctctccagagagactgccttcgtttctatgggtacggaaacatggttgct
ttcttcagatattctcctgttgatattctctcagttaacctacccccctcagtactggat
ttcaattgccgcagtcgacaagattggatgagaaggatggcagttgagatatatagcaaa
atggagaccttacattcagaggtatatgattttcttcatcataatgaaaatagtgttaca
tcagaggatgagccggtgaaagcaggtgttcaaaggcagatcatagagatgaaagatttg
cttaaaatggaaagaaatggatatgagatcctgctgttgccagttattacagatagcaat
cattctgtgcaggtctctattgatgttcttgagctcaaccgcttgagacgcggtcttctc
cttgatgcttacatttgggatcgaaggctttgttacatagattcactccttaaaaaagac
agtcatgtttcaaatcctgatattttcttagatgtcagactgaaagagtggaaagctgac
ctgcttgtgggggatacaaaaataggaaaatccacaaatttgtcgcaatcttcaggaagt
ccaagaaaatccttgctatctagagaaggctgcttgaatgatacggaatacaggatgggt
gagacaaattcacagattgatcttgtaactcatcctgtggatgatgcagaagatctggac
aaggttttccgcagattcaatggagagacagagcagccagttactacagctacaatgggt
aaggaacctgttgaaaggttaccctcacttgcatctattttttcagataagattgatttg
gcatggactggatctagtgagatacaagatgaccttctacaaggttttaccaaaattgat
gagtatggatcgtttaatttcccagacaatccaagctatgggaattctgtaacccctgtc
agaattcattcatttgattctaaatttgctatacaccagcgagaacgcaatggattggct
cctacttcattgcatctgtcgtcattcagatctgctgaatactttggggattttactagt
atcctgaaagatccaatgccaaacatacggagggcttgttctcaaaggtctcctggtgca
gtagagaaattaaatgttgttcttacccgtacacttacatatatctcatctgcttcacat
atgatcgatgatggggcacggctgctgttgcctcagattgggtatgaagatgatgctgtc
attgcagtctatgatgatgagcctaccagtatcgtgtcctatgcaatgacttcacaagaa
tatgtgcagcaagtcacacgcaaactgaattcaagtttgagtttcttacacctaccaaat
gccattgacagcagccatggacttgacgggaccttgctctcacaagaagaccatttggat
tctaagggaactcactttaagttttcttttgatgatgaatcgccactttctgaagataaa
gcaaagttttccattacttgttatttcgcaaagcattttgccgcacttaggaagaaatgc
tgcccaaaggatattgatttcatccgttcacttagccgctgcaagagatggaatgcgcaa
ggtggaaaaagcaatgtttactttgcaaagactcttgatgagagattcataatcaaacaa
gtcaccaggacagagcttgaatcgtttgtagagtttgctcctcagtacttcagatatttg
atggaatccctgacttcaggtagtccaacttgcctggccaaaatcgtaggagtatatcag
gttaatatcaagggcttaaaaggtggtagggaagtaaagatggacctcatggtgatggag
aatcttttctttgaaaggaagatatctagagtctatgatctaaagggttcattgcgctca
cgctatacatccagtgagagtaaagtcctcttggattcaaacctcctagaggcattgcat
acaaagccaatatttttagggagcaaggcaaaacgaagattggaaagagccgtttggaat
gacacttcttttcttgcgacagcggatgtcatggattactcactacttgttggaatcgac
gaggagaagaaagagcttgtcattggcattattgactacttgcgccagtacacctgggac
aagcagctcgagacctgggtgaaagcttcaggcatcctgggaggccccaagaacgagtcc
ccgaccgtcatatctccgatgcagtacaagaagaggttcaggaaagccatgtcaaagtac
ttcctcaccgtccccgatcagtggtcctcttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345725
Entry
4345725           CDS       T01015                                 
Name
(RefSeq) 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B
  KO
K00921  1-phosphatidylinositol-3-phosphate 5-kinase [EC:2.7.1.150]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00562  Inositol phosphate metabolism
osa01100  Metabolic pathways
osa04070  Phosphatidylinositol signaling system
osa04145  Phagosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    4345725
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    4345725
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    4345725
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4345725
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.150  1-phosphatidylinositol-3-phosphate 5-kinase
     4345725
Membrane trafficking [BR:osa04131]
 Endocytosis
  Macropinocytosis
   Kinases
    4345725
 Endosome - Golgi transport
  Others
   Others
    4345725
SSDB
Motif
Pfam: PIP5K Cpn60_TCP1 FYVE
Other DBs
NCBI-GeneID: 4345725
NCBI-ProteinID: XP_015649930
UniProt: A3BTP9
LinkDB
Position
8:22001100..22011828
AA seq 1831 aa
MMGSPEGRLVELFGAVKSWMPRRGDHSPPPPLPPPPASQVGAGGGGGAASPQPHDLSRDF
WMPDQSCRVCYDCDAQFTILNRRHHCRHCGRVFCARCTANSVPRAPGDAAREDGERIRVC
NYCFRRWLEEEAAARRDVAQPSSPVLSPSASAVSIGSDKSSSTARSSAGTNGQMSSYTNV
SYTDFPSMAVEGQGECCEREGCAEKQLPAMEPAGGVEPATYVDNTSDPYNFGINRSDDED
DDYAVFHSDSKTQHLQNSDEYFKTVCFDAHQVDCSHVKESVSPMQDTENFIGSVGVDKTG
DHIMDNTEECNTRSSSLYSMEMLENEPVDFENNSSLWLPPEPEDEEDDHDGALCDEDDGE
DATGEWGYLRSNSFGSGHCRSRDKSAEEHKRAMKDIVDGHFRALVAQLLQAEKVQLVDKS
GKQSWLDIVTSLSWEAASILKPDTSKGGRMDPGGYVKVKCLACGRPSDSFVVKGVVCKKN
VAHRRMASRKEKPRILILGGALEYQRISNLLSSFDTLLQQETDYLKMAVAKIKAHQPSVV
LVEKSVSRYAQDLFLEKNISLVLNIKRPLLERISRCTGAHIVPSIDYVSSQKLGHCDLFH
VEKYVEEHGTAGEGGKKMLKTLMFFEGCPKPLGCTILLKGANGDELKKVKHVVQYGVFAA
YHLALETSFLVDEGATLPELPLKSPIIVALPDKPSSADRSISTIPILQMPTASSPNDSLQ
AFDVQTDGSTFNGFQTMDQTMVMCSPEYKSCKKLGAGSAQTESAHFNGQDKNIACLHGMV
PWSSTDPLVQQSASSLCHCPSCSRDVVNKKHFEERQPETSGHTLDNDFNALSAHRTNLES
VESGHLFAYNSENGDKIRAKLSVPLNVQISLDDDSSKDDSVIKKDEIPASPADNQSILVS
LSSRCVWKETVCQRPHLLRIKYYGNFDKPLGRFLRDQLFDQNNNCISCELPPEAHVYCYV
HPQGSLTISVRKLAVKLPGEHDGKIWMWHRCLRCPRVIGLPPATKRVVMSDAAWGLSFGK
FLELSFSNHAAASRVASCGHSLHRDCLRFYGFGEMVACFRYASIKVHSVYLPPPKLDFTS
QHQEWVEQEANEVVDSAELLFTEVLNALHQISEGRPITGSFDGNMKILELRRNIMELEEI
LQIEKADFTESLKNLLNKEIRKGKPFIDILEVNKLRRQLLFLCYLWDQRLIFIANSGGKY
CDTLGGLRVGSRSSDSNDKSVDTNATTKLEKSSKGSEVLSNAKEGSLKQSQSPLHANDKE
PNQPDQSNGNSSRIGAGLNGMEDAIAKINHSNSADVKDNLDHQESSIGVRRVLSDGQFPV
NADISDTLDAKWRGENGTVPDTSILKPLALLEGSADLKNQAKAVPTNASLSVRSGDTVED
LSSWLKMPYMTFYDSLNTNSGTAPRFGALADYNPVYITLFRELSQQGGARLFLPTGANDV
VIPVFDDEPTSIISYALVSPMYCHQMLDENSKNKDGPDSSLPLPVYDSGNFNPFHLFEDF
GSADDLASSISGTRGSFVPDLVHLRVPFEDGGPLGKVKYTVTCYYAKSFEALRRSCCPSE
LDFLRSISRCKKWGAQGGKSNVFFAKSLDDRFIIKQVTKTELESFLKFGLDYFKYLSESI
STGSPTSLAKILGIYQVTIKHVKGGKESKMDLLVMENLLFGRNITRLYDLKGSSRSRYNA
DSSSNKVLLDQNLIEAMPTSPIFVGNKAKRLLERAVWNDTSFLAGIDVMDYSLLVGVDEE
KHELVLGIIDFMRQYTWDKHLETWVKSSGILGGPKNAPPTVISPMQYKKRFRKAMSAYFI
VIPEQWMPAIINPSKSSSNLCQEDPQNASQE
NT seq 5496 nt   +upstreamnt  +downstreamnt
atgatgggatcaccggaggggcggttagtggagctgtttggcgcggtgaagtcgtggatg
ccgcggcggggagatcactctccgcctccgccgctgccgccgccgccggcgtcgcaggtg
ggtgctgggggtggtggtggcgcggcatcgccgcagccgcatgatttgtcgagggacttc
tggatgccggaccagagctgccgcgtgtgctacgactgcgacgcgcagttcaccatcctg
aaccggcgccaccactgccgccactgcggccgcgtgttctgtgcccggtgcacggccaac
tccgtgccgcgcgcgccgggggacgccgcgcgtgaggacggcgagcggatcagggtctgc
aattactgcttcaggcgctggctggaggaggaggcggcggctcggagggacgtggcgcag
ccatcgagcccggtgctgagcccgtcggcgtctgccgtgagcatcgggagcgacaagtcc
agttcgactgcgcgtagcagcgccgggacgaacggccagatgtcgtcttacacgaatgtt
agctacactgacttcccatctatggcagtcgagggccagggtgagtgctgcgagagggaa
ggttgtgcagagaagcagctgcctgcaatggagccggctgggggcgtggagcctgcgact
tatgtggacaacacatcggatccatacaattttggcataaataggagtgatgatgaggat
gatgattatgcagttttccactcagattcaaaaacacaacacttgcaaaattctgatgag
tacttcaaaactgtgtgttttgatgctcatcaagttgattgtagtcatgtaaaagaatct
gtttctccgatgcaagatacggaaaattttattggttctgtgggagtagataagactgga
gatcacatcatggataatactgaggaatgcaatactcgatcttcttccttgtatagcatg
gaaatgctagaaaatgagcctgtagattttgaaaacaatagctcactctggctgcctcct
gaacctgaggatgaagaggacgaccatgatggtgctttatgtgatgaggatgatggggag
gatgccacaggagagtggggatatctacgctcaaacagttttggcagcggacattgtcga
agtagagataagtcagctgaggaacacaagagagccatgaaagacattgttgatgggcat
tttcgggcattggttgctcaacttcttcaggcggaaaaggtacagttggttgataaatct
ggcaaacagagttggctagatatagttacttctctgtcttgggaagctgcatctattcta
aaaccagataccagcaaagggggacggatggaccctggtggctatgtgaaggtgaaatgc
ttggcttgtggtcgtccaagtgatagttttgttgtaaaaggagttgtttgtaagaagaat
gttgctcatcggcgcatggcgtcacggaaagaaaagccacgcatcctgatccttggtggt
gcacttgaatatcagcgcatatcgaatttgctttcaagttttgatactttactgcagcag
gaaacagattatttgaaaatggcagttgcaaagatcaaagcccaccaaccaagtgtagtg
ttggtagagaaatctgtgtctcgatatgctcaggatttattcttggagaaaaacatttca
cttgttctgaatatcaaaaggccacttctggaaaggatatcacgttgcactggtgctcat
atagttccgtcaattgattacgtgtcatcccaaaagcttgggcattgtgatctattccat
gtggagaaatatgttgaagagcatgggactgctggagaaggtggaaagaaaatgctgaag
acccttatgttttttgaaggctgcccaaagcccttgggttgtacaatattgctcaaagga
gctaatggcgatgagctgaaaaaagtgaagcatgttgtgcaatatggagtctttgcagcc
tatcacttggctctggaaacatcttttcttgtggatgaaggtgcaacacttccagaactc
cctcttaagtcaccaattattgttgctttgccagataagccttctagtgccgatagatcc
atttcaactatacctattttacaaatgcctactgcttcatcaccaaacgatagcttgcaa
gcatttgatgtgcaaacggatggttcaacatttaatggttttcaaacaatggaccaaaca
atggtaatgtgctctcctgagtataaaagctgcaaaaaactgggagctggttctgcccaa
accgaatctgcccatttcaatggccaggataaaaatattgcctgtttgcatggtatggtt
ccttggtcatctactgatcccttggttcagcaatcggccagttcactttgtcattgtcct
tcttgttctagagatgtagttaataaaaagcattttgaagaacgtcaacctgaaacatct
ggacataccctggataatgatttcaatgcgttgtctgcacatcgaacaaatttggagtct
gttgagagcggtcacttatttgcctataattctgagaatggtgacaagataagagctaaa
ctgtctgttcctctcaatgtgcaaatttctcttgatgatgacagttcaaaggatgattca
gtaataaaaaaagatgaaattccggcatctcctgctgacaaccagagtatattggtttct
ctgtcttcccgttgtgtttggaaagaaactgtttgtcagcggccacaccttctccgcata
aagtattatggcaactttgacaagcctttaggaagatttctgcgtgaccagctctttgat
cagaacaataattgtatctcttgtgagttgccaccggaggcccatgtttattgctatgtc
cacccgcaaggcagcttaacaatttcagtgaggaaacttgcagtgaagttgcctggtgaa
catgatggtaaaatatggatgtggcatagatgcttacgatgtcctcgtgttattgggctc
cctccagcgactaaaagagtagtgatgtctgatgctgcctggggcttgtcctttggaaaa
tttctggaacttagcttctcaaatcatgcggcagctagtagggtagccagttgtggccat
tctcttcacagggattgccttcgtttttacggctttggtgaaatggttgcttgcttccga
tatgcatcgatcaaggttcattcagtgtatttgccaccaccgaaacttgatttcacttct
cagcaccaggaatgggtagagcaagaagcaaatgaggtggttgactcagctgaacttctg
ttcactgaagtactgaatgcactccaccaaatttcagagggaaggccaattacaggttct
tttgatggcaacatgaaaatcctcgagttaagaaggaacatcatggagctggaagagatc
ctgcaaatagagaaagcagattttacggaatcattgaagaatctactgaacaaggagatc
agaaaggggaagccattcattgatattcttgaggttaacaaactaaggaggcagctactg
tttctgtgttacctgtgggatcagcggctaatctttatagcaaattcaggtggcaagtac
tgtgacacactaggaggtttacgggttgggagtaggagttctgactctaacgataaatca
gttgataccaatgcaactacaaaactagagaagagctcaaagggctccgaagttctttca
aatgctaaggaaggatccttgaagcagagccaaagtccacttcatgctaatgacaaggag
cccaaccaacctgatcaatctaatggaaatagttcaaggattggtgcagggttgaatggc
atggaagatgcgattgccaaaatcaatcattctaacagcgcagatgttaaggataacctg
gatcatcaagaatccagtattggtgttcgtagggttctttctgatggtcagtttccagta
aatgctgatatttcagacacattggatgcaaaatggagaggtgaaaatggaacagttcct
gatacaagtatcctgaaaccattagctctgctagaaggttcagctgatcttaaaaaccaa
gctaaggcagtgccaaccaatgcttctttatctgtcaggtctggagatacagtagaagac
ttatcaagctggctcaaaatgccatacatgacattctatgactccttaaacacaaattct
gggacagcaccgagatttggggccctggctgactacaatcctgtgtacattacattgttc
cgtgagttatcacagcaaggtggagcaagactttttctgccaactggagctaatgatgtt
gttattccagtatttgatgatgaaccgaccagtataatttcttatgcacttgtttcaccc
atgtactgtcaccaaatgttggatgagaacagcaagaacaaagatggtccagattcttca
cttccattgcctgtatatgattctggaaattttaatccttttcatttatttgaggatttc
ggatccgctgatgatcttgcttcgtcaatatctggaaccagagggtcatttgttcccgat
ctagttcacctaagagttccctttgaggatggtggcccactcgggaaggtgaaatacaca
gtgacgtgctactatgcgaaaagctttgaagctcttagaaggtcttgctgtccatctgaa
cttgactttttaagatctatcagtcgatgcaagaaatggggagcacaaggtggcaaaagc
aatgtgttttttgcaaaatctctggatgatagatttataataaagcaggtcacaaaaaca
gaacttgaatcattccttaagtttggactagattattttaaatatttatcagagtctata
agcaccggaagccctacatcccttgcaaagattctgggaatctatcaggttacaattaag
catgtgaagggtggcaaggagtcaaaaatggatttacttgtgatggaaaatcttttattt
ggacggaatattacaaggctctatgatctcaagggatcttcgaggtcaaggtataatgct
gattccagcagcaacaaggttcttcttgaccagaacttgattgaggcaatgccaacgtca
ccaattttcgttgggaacaaggcaaagaggcttctggaaagagctgtttggaatgatact
tcctttctggcaggaattgatgtgatggattactcattgcttgtgggagttgacgaggag
aaacatgaattggttctgggaataattgattttatgaggcagtatacatgggacaagcac
ctcgagacatgggtcaaatcgtccggtattctcggcgggccgaagaatgcccctccaact
gtgatttcacccatgcagtataagaagcggtttagaaaagctatgtctgcttattttatt
gtaattccggagcaatggatgcctgcaataatcaatccgagcaaatcatcatcaaatctt
tgccaagaagatcctcaaaatgcttcacaagagtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347005
Entry
4347005           CDS       T01015                                 
Name
(RefSeq) putative 1-phosphatidylinositol-3-phosphate 5-kinase FAB1C
  KO
K00921  1-phosphatidylinositol-3-phosphate 5-kinase [EC:2.7.1.150]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00562  Inositol phosphate metabolism
osa01100  Metabolic pathways
osa04070  Phosphatidylinositol signaling system
osa04145  Phagosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    4347005
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    4347005
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    4347005
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4347005
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.150  1-phosphatidylinositol-3-phosphate 5-kinase
     4347005
Membrane trafficking [BR:osa04131]
 Endocytosis
  Macropinocytosis
   Kinases
    4347005
 Endosome - Golgi transport
  Others
   Others
    4347005
SSDB
Motif
Pfam: PIP5K Cpn60_TCP1
Other DBs
NCBI-GeneID: 4347005
NCBI-ProteinID: XP_015612403
LinkDB
Position
9:complement(14110006..14118709)
AA seq 1611 aa
MGVVDFAAMVGAVEKVRSIVASHAHQHKGGGGDGDGEARRRYQGEGAPRPRSPESRSAFE
PPTPPRARAPDARSGTKGDAAPCSPPPCRDIRRADEEIDEPRVQFFAPGTYFSHDSSDSD
SSVSVANSMYRSVTPSPSESPTVRQNDASDHGATTMSDSDDAREHVGASIASWCEEEHKS
FRIVDFDDDIWYPPPPEDESDDVESKLCAFDDEDDEYGDSSNFVVPNCFSADKFAGVDSS
VNGSHIENVQNDLLRHFQALVAQLLTGEAISLARDKESKGWLEIVSSLAWQAANFVKPDT
KKGGSMDPSDYVKIKCIASGKPSESNFVKGIVCSKNVKHKRMVSEHQNATLLILGGALEY
QKVSNKLASIGTILEQEKEHLRMIVGKIESRRPNVLLVEKSVSSFAQELLAKDISLVLNV
KRPLLDRISRCTGGQIASSIDNIASARLGHCDTFKVEKVLESSTEHSEKKSTKTLMFFEG
CMKRLGCTVLLRGACRDELKRIKRVMQLAVFAAYHLSLETSFFADEGATLPRVPSTSSVG
APEMQTNREHLSSCYANQGSPVSLRTEEEKYAHNASISQIFNGISGPPTFLPLDGESQGI
VSEHREVESPANHIKGDNSFHSHHPNALCNVHSVSLGNNLGSMGVTPYYDPCNSLQSPVG
VSANILGEVHNLENCGCPISLDDFHVGGLNDQNKLSGGYFPGTDNHQSILVSFSSTCIPK
SLACERSHLFRIKFYGSFDKPLGRYLREDLFDQAYCCPSCKEHSESHVRCYKHQHGSLTI
SVRRLVSQKLPGEHDGRIWMWHRCTRCKLEDGMPPASHRVIMSDAAWGLSFGKFLELSFS
NHATANRLASCGHSLQRDCLRFYGYGNMVAVFQYSPMVTLSVNLPPSMLDFNCHSTQEWV
KGEAVAVFGEMESLHAEVYGFLSNTEKSIITMDESLKTGIERQIIEMKDLLNMERNEYET
LLLPVIRGSTHSMKSSIDILELNRLRRGLLLDAYIWDCRLCNISSITKDGRASRIKGSEA
ELHQAITNHGEMHQEPSTCPQCSSGSLRKSLLSREGHSMDTEIILPEIDLPVGMVDSFVH
DIGGLDLVFSKFDVSGIAQSLSKDSIKTEPVERLPSLASILSDKIDMAWSGSCELHNNLP
ESTTKGNENPSYSKAIPPVRIHSFDSIFRLHQRESTGLLPASLHLSSKSVDSFRDLTSLV
KDPLTNMRRAFSHISPRERGNLNVLTHLPTYIRSAAHMVSDGARLLLPHIDFEGGVVVAV
YDDEPTSIVSYVMTSQEYIEHITHKMDTKSSFHHPVNCAVASNNQFEESFLPQEGHSEFK
GTHFSFSFDDEAFSADNTKFSVTCYFARQFAALRKKCCPGDIDYIRSLSRCKRWSAQGGK
SNVYFAKTMDERFIIKQVTKTELDSFIGFAPHYFRHLAESLTSRSPTCLAKIMGLYQVNI
KGLKGGREVKMDLMVMENIFFQRTISRVYDLKGSVRSRYNSDTSGHNKVLLDSNLIEAQH
TNPIFLGSKAKQRMERAVWNDTSFLASLDVMDYSLLVGVDERKNELVIGIIDFLRQYTWD
KQLETWVKASGILGGSKNEAPTVISPVQYKKRFRKAMSRYFLAVPDDWSSS
NT seq 4836 nt   +upstreamnt  +downstreamnt
atgggcgtggtggatttcgcggcgatggtgggggcggtggagaaggtcagatccatcgtc
gcaagccacgcgcaccagcacaagggcggcggcggcgacggggacggggaggcgcggcgg
cgctaccagggagagggcgcgccgaggccacgcagcccggagtcgcgctccgccttcgag
ccgcccacgccgccgcgcgcccgcgcgcccgacgcgagatccgggaccaaaggcgacgcc
gctccctgctcgcctcctccctgccgcgatattaggcgagcagatgaggagattgacgaa
cccagggtccagttttttgccccagggacttacttctcacatgactcttcagattcagat
tctagtgttagtgttgctaactcaatgtacagatcagtaaccccaagcccatcagagagc
cctacggttaggcagaatgatgcttctgatcatggtgctacaaccatgtctgactcagat
gatgctcgggagcatgtcggtgctagcatagcttcctggtgtgaagaggagcataaatca
ttccgtattgttgattttgatgatgatatttggtacccaccacctcctgaagatgagagc
gatgacgttgaatcaaaattatgtgcatttgatgatgaggacgatgaatatggtgactcc
agcaattttgttgtgcctaattgcttcagtgctgataaatttgctggtgttgatagttcc
gttaatggatctcacatagagaatgttcaaaatgatttgctaaggcattttcaagctcta
gttgcacagttgttaacaggggaagctattagtttggccagggacaaagaatcaaaaggt
tggcttgagatagtgtcctctttggcatggcaagcagctaactttgtgaaacctgataca
aagaaaggtggtagcatggatcctagtgattacgtgaagattaaatgcatagcatcgggg
aaaccaagtgagagcaattttgttaaaggaattgtttgctccaagaatgtaaaacacaaa
cgcatggtctctgagcaccagaatgccacattgctcattttaggaggggcacttgaatac
cagaaagtttctaataaactagcctcgataggaactatacttgaacaggaaaaggaacat
ctcagaatgattgttggaaagatcgagtcaagacgacctaatgtgctgcttgttgagaaa
agtgtctcttcttttgctcaggagctcttagcaaaagatatttcattagttctgaatgtg
aagaggccacttttggataggatatcaagatgcacgggtggtcaaattgcctcatcaatt
gacaacattgcctcagcaagactaggccattgtgacacgttcaaggtggaaaaagttcta
gaatcctcaacagaacattcagagaaaaagtcaactaagacacttatgttctttgaaggc
tgtatgaagcgtttgggttgcacggttctactcagaggagcttgccgggatgaattaaaa
agaattaagcgagtaatgcaacttgcagtctttgctgcttatcatctctcccttgaaacg
tcattctttgcggacgagggtgcaacacttccaagagttccttcaacatcttctgtaggt
gcaccagaaatgcaaaccaatagagagcacctatcatcttgttatgctaatcagggtagt
cctgttagtttgagaactgaagaagaaaaatatgcacacaatgcttctatcagccagatc
tttaatggtatttctggaccgccaacttttttaccattggatggggaaagccagggaata
gtatctgaacatagggaggttgaatcccctgccaatcatattaaaggtgacaattcgttc
cactcgcaccatccaaatgctttatgcaatgtgcattcagtttccttgggcaacaacctt
ggtagtatgggtgtgacaccatattatgatccgtgcaactctttgcaatccccagttggt
gtttcggctaatatacttggagaagtacataatctggaaaactgtgggtgccccatatca
ctagatgactttcatgttggaggcctgaatgaccagaacaagctttcaggtggttatttc
cctggtactgacaaccatcagagcatcttagtttcattctcaagcacatgcatcccaaaa
agcttggcatgcgagcgttctcacctcttccgcatcaaattttatggtagctttgataag
ccacttgggagataccttcgagaagacttatttgaccaggcatattgctgcccgtcatgt
aaggagcattcagaatcacatgttaggtgctacaagcaccagcatggaagcctaacaatc
agtgttagacgtcttgtatctcaaaaattaccaggtgaacatgatggaaggatatggatg
tggcacagatgcacgagatgcaaactcgaggatggaatgcctcccgcatcacatagagta
atcatgtccgatgctgcttggggtctatcatttgggaaattcctagagctcagcttttcg
aatcatgcgactgccaaccgacttgccagttgtggtcactctctccagagggactgcctt
cgtttctatgggtacggaaatatggtagctgtcttccagtacagtcctatggttacttta
tctgttaacctgccaccctcaatgctagatttcaattgccatagtacacaagaatgggtt
aaaggagaggcagttgcggtatttggtgaaatggaatccttacatgcggaggtatatgga
ttcctttctaatactgaaaagagtatcataaccatggatgaatcattaaaaactggcata
gaaagacagatcattgagatgaaggatttgcttaacatggaaagaaatgaatatgagact
ttgcttctaccagttatcagggggagtacccattccatgaaatcaagtattgatattttg
gagctcaaccgtctgagacgtggtctcctcctagatgcttacatttgggactgcaggctt
tgtaacataagttcaataacaaaagatggccgtgcttctagaataaagggttcggaagct
gaattacaccaggcaattacaaatcacggagaaatgcatcaagagccttctacttgtcca
cagtgttcttcaggaagtttaagaaaatctctactatctagagagggccattccatggac
actgagattatcttgcctgagatagatttgccagttggtatggtggatagttttgtgcat
gatataggaggccttgacttggttttcagcaaatttgatgtgtcgggaatagcacagagt
ctatcaaaagattccatcaagacagaaccagtggagagattaccctcacttgcatctatt
ttatctgataaaatagatatggcatggagtggatcttgtgaattacacaacaacctccct
gagagtacaaccaaaggcaatgaaaatccaagttacagtaaagcaatcccccctgttcgc
atccattcatttgattctatattcagattgcatcagcgggaatcaacgggattattgcct
gcttcattgcatttgtcctcaaagtcagttgattcctttcgagatttgacaagcctagta
aaagatccgctgacaaacatgcggagggccttttctcacatatctcccagggaaagagga
aacttaaatgtccttactcatttgccaacgtatatcaggtctgctgctcatatggtgagc
gatggggcacgactattactgcctcatattgactttgaaggtggcgttgttgttgctgtc
tatgatgatgagccaaccagtattgtgtcgtatgtcatgacatcacaagaatacattgaa
cacatcacacataaaatggatacgaagagcagctttcatcatccagtaaattgtgctgtg
gccagtaataaccaatttgaggaatcttttctcccacaagaaggccattcagaatttaaa
ggaacccacttcagtttttcttttgatgatgaagcattttctgctgataatacaaagttt
tctgtgacatgttattttgcaaggcagtttgctgctcttagaaagaaatgctgcccaggt
gatattgattacatacgctcactaagtcgttgtaagagatggagtgcacaaggtggaaaa
agcaatgtatactttgcaaagacaatggatgagagattcataattaaacaggtcaccaag
acagagctggactcttttataggatttgctcctcactatttcaggcacttggcagaatca
ctaacttctaggagcccgacttgtttggctaaaataatgggactttatcaggttaatatt
aagggcttgaaaggagggcgtgaggtaaagatggatcttatggtgatggagaacattttc
ttccaacgaacaatatctagggtctatgacctaaagggttccgtgcggtcacgctataat
tctgatacatccggccacaataaagtacttttagattctaatctcatagaggcacagcat
acaaatcctatatttttggggagcaaggcaaaacaaagaatggaaagagctgtctggaac
gatacatcattccttgcgtcattggacgtcatggactactcgcttctggtcggcgtagac
gagaggaagaacgagctcgtgatcggcatcatcgacttcctccggcagtacacctgggac
aagcagctggagacgtgggtgaaggcctccggcatcctgggcggctccaagaacgaggcc
cccaccgtcatatcgccggtccagtacaagaagaggttcaggaaggccatgtcgaggtac
ttcctcgccgtccccgacgactggtcctcatcataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9269751
Entry
9269751           CDS       T01015                                 
Name
(RefSeq) putative 1-phosphatidylinositol-3-phosphate 5-kinase FAB1D
  KO
K00921  1-phosphatidylinositol-3-phosphate 5-kinase [EC:2.7.1.150]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00562  Inositol phosphate metabolism
osa01100  Metabolic pathways
osa04070  Phosphatidylinositol signaling system
osa04145  Phagosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    9269751
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    9269751
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    9269751
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    9269751
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.150  1-phosphatidylinositol-3-phosphate 5-kinase
     9269751
Membrane trafficking [BR:osa04131]
 Endocytosis
  Macropinocytosis
   Kinases
    9269751
 Endosome - Golgi transport
  Others
   Others
    9269751
SSDB
Motif
Pfam: PIP5K Cpn60_TCP1 zf-RING_UBOX
Other DBs
NCBI-GeneID: 9269751
NCBI-ProteinID: XP_015620016
UniProt: Q2QVA9 C7JA93
LinkDB
Position
12:7520723..7534958
AA seq 1677 aa
MRKMCHSCESEDATMDGVDDGLICSTSCYNMCGHADKSSIIDGEIGCPSMEISPCNTPYG
TPLFSRESSCSSFASCFSSLDDYLVETDSEEEIEVLDTGQLHPGILFSDESMEQRTVGSV
QVEECQVSHAAVVDDDSSISIPTNQNISSGQQQLEIHLDATNENSVPSNVIIDANVTDPH
QDVISNGGLIEACYGVPLDDIDLKQSNILDGEEITSLPMADNEMTPLNDQIMDQIDDMKE
ISTIVYNNTISAEQHANSGSEFEKGNESSENLYPLVMPSFDTDPHIWLPPDPVNKDDDTD
IVANNDDNSDNNDSWVQSSFNISFDAKRNKTSCEDQLQKAMSEVMNGQFKILVSRFLAAE
GLSLSDGEADKNWLDIVASLSWHAALLVKPDANVGNAMDPCMYVKVKCIASGSIEQSEVI
NGLVFKKSAAHKQMRANMKNPRLLLLQGVVGHSSAGLLSMDSMKQENDHLEKILSDVITK
CKPDAILVEKAVSRNVNEYIHKQGVTVVSDMNIRRLERIARCTGSPIFLLQNVLATPNLI
KQCESLHFEKFIEEHNITGGGKRSAKTLLFLEGFRKPLGCTILLKGSTSEELKKVKRVLH
FTVFAAYHLILETSFFADQRLFATGKNAMEKGNCLKTDPQLLVPCTAAPSSKFCSDIAQN
SDPTQHALNILASDGQYVNQDDFVNPEKSVCMHDSKIETSREHADRKLDDSNNIQSYSSL
PVPDPSRNLIGDMSLDFAKLASCDDFAGSTSGAPSNNGVLQTYGADGKDCLETISDGIST
GTRTSLDSQNILISMSSQHIRNQAICEQSHLSRITYYGYFDTSLGRYLQDSLLNEKHNCL
SCGEPPEAHMYSYTHHNGTLTVLVKSLPLDVTLSGKDQGRIWMWTRCLRCNGKPTQRVII
SSSARNLSFGKFLELSFSTHSAAKKLSTCGHLLHRDCLRFFGMGPKVAMFRYSSVEIYSA
FKPPLTLEFHNPNKKECREVEFNNVLRKWRLLLSEAENKIQILKSGGSGQALGENTKVSV
HEELFLEVNRILAQEKYEFGVYPKTFDFLVKSGTCAHEILGLNWLHQLLLLGIYIWDVRL
QHILQYCKANAASPDSTIQIKTPENKPKNSEITSVHGDTLSLTNVGMERQEARIDTCHSF
DSSFGGMILENEQLTEKSVIQEPGSHVSPDHREDGGSYEVDKYAHISDSFCLEKLIDLPV
KNNELPELARGNEMYPVAKPSKCFDIFLNLFDFLSNDARKWVWGSFSHLEKEYKKELQGG
SLDKFHLINKYIPTFSSLVQLKSQMDMVQFIVGPGGSILSIVEEEASSMIAYALLISEQQ
GIYSEAAIVKDEVIAGRKIDKVTPINSIGDTPVPSAILSPNDSLEQDHNLSRNVSSLSSE
ESTSGFYDSFLSALKDLHPEFCLNNEKLTLKSKYTVLCIYAKQFYDLRKICCPSEIAYIS
SISRCKEWNAQGGKSKAFFSKSMDDRFIIKQIKKTEFDSFLKFGLEYFKHFGVSQASVNP
TCLAKILGIYQVKEIRNGKEARTNFMVMENLLFGRNIIRRYDLKGALFSRYVLDSKNPEN
VLLDQNFIEDMRAMPIYIEGKTKNLLERAIWNDTAFLSRMNVMDYSLFVGVDKQKKELVF
GIIDYLRQYTWDKQLESWVKTSLFVPKNLSPTVISPKEYKIRFRAFMSQYFLSVPDA
NT seq 5034 nt   +upstreamnt  +downstreamnt
atgagaaaaatgtgccattcatgtgaatcggaagatgcaacaatggatggggtcgatgat
ggccttatctgtagtacttcttgctataatatgtgtggccatgctgacaaatcttcaata
attgatggtgagattggttgtccaagcatggaaataagcccttgcaacactccttatggc
actcctctttttagccgagaaagttcttgttcaagctttgccagttgcttttcaagcctc
gatgactacctagttgaaactgactctgaagaggaaattgaggtcttagatactggccaa
cttcatcccggcatcttattctctgatgaatcgatggagcaaagaacagtgggttctgta
caagtggaagaatgtcaagtcagtcatgctgctgttgttgacgatgattctagtatttcc
attccgacaaaccagaacatttcatctggtcaacagcagttggagatacatcttgatgct
accaatgaaaattctgttccatccaatgttattatagatgcaaatgtaacggatcctcat
caagatgtcatttccaatggtggacttatagaagcatgttatggtgtaccattggatgat
attgatctcaaacaatccaatatcttagatggtgaagagattactagccttcctatggct
gacaatgaaatgactccactgaatgatcaaattatggaccaaattgatgatatgaaggaa
attagtactatagtttacaacaatacaataagcgctgagcagcatgcaaattcaggttca
gagtttgagaaaggaaatgaatccagtgaaaacctttatccgctagtaatgcccagtttt
gatacagaccctcacatttggttaccaccagacccagtcaataaggacgatgacactgat
attgttgctaataacgatgataatagtgacaacaatgatagttgggtacagtcaagtttc
aatattagctttgatgcaaagagaaacaagactagttgtgaagaccaattgcagaaagca
atgtcggaagttatgaatgggcaattcaagattcttgttagtcgttttttagctgctgaa
gggctctctttgtctgatggagaagctgacaagaactggcttgatatcgttgcttcacta
tcatggcatgctgcattacttgtcaagcctgatgccaatgttggaaatgcaatggatcct
tgtatgtatgttaaggtgaaatgcatagcttcaggatctattgagcaaagtgaagtcatc
aacggccttgtttttaagaagagcgctgctcataagcagatgcgtgccaacatgaagaat
cctagactgttacttctgcagggtgttgttggccattcttctgcagggctattgtcaatg
gattcaatgaaacaggaaaacgatcacttggagaaaattctcagtgatgtaattaccaaa
tgcaaacctgatgctatattggtggagaaagcagtctcacgaaatgtaaatgaatatatt
cataaacaaggagtcactgtagttagtgacatgaatatccgtcggctggaaagaattgct
cgttgcactggttctccaattttcttgttgcagaatgttcttgcaacacccaaccttatt
aaacagtgcgagtctctacattttgaaaagtttattgaggagcataatataactggagga
ggaaagagatcagccaaaactttgttatttctagaaggttttcgaaagcctttgggatgc
acgattttgctaaaaggatcaacaagtgaagaactgaagaaagttaagcgtgttcttcat
ttcactgtttttgcagcttatcatttgatccttgaaacttcattctttgctgatcaaagg
ttatttgcaacgggaaaaaatgccatggagaaaggcaactgtttgaaaactgatccacag
ctgcttgttccttgtactgctgctccgtcctccaaattctgttctgatattgcacaaaat
agcgaccccacacaacatgctttgaacattcttgcttctgatggacagtatgttaatcag
gatgattttgttaatccagagaaatccgtatgcatgcatgattccaaaattgaaacatct
agagagcacgcggacagaaaacttgatgacagcaacaacattcagtcatattcatcattg
ccagttcctgacccctcgagaaatcttattggcgatatgtcgttagattttgccaaattg
gcatcatgtgatgactttgccggttccacctctggagctccttcaaacaatggggttctg
cagacgtatggggcggatggcaaagattgtctagaaactattagtgatggaatatctaca
gggactaggacttctttagattctcagaacatattgatttcgatgtctagccaacatatc
agaaaccaagcaatctgtgagcagagtcatctttcccgcataacttactacgggtatttt
gatacatcacttggtcgttatttgcaagatagtttacttaatgagaaacacaactgctta
tcttgtggtgaacctccagaagctcacatgtactcttacactcaccacaatggcactcta
actgttcttgtgaaaagccttcccttggatgtaactctttctggtaaggatcaaggaaga
atttggatgtggactaggtgtttgagatgcaatggtaagcccacccagagggttataatc
tcttcctctgcgcgtaatctgtcatttgggaagttcttggaactcagtttctcaacacat
tctgctgctaagaagctatcaacatgtgggcatttgctgcatagggactgcctacgcttc
tttggaatgggacccaaagttgctatgttcagatactcatctgttgaaatatattctgcc
tttaagccaccattgactttggagtttcataacccaaacaaaaaagaatgccgggaagtt
gaatttaataatgtacttcgaaaatggaggctactcttatctgaagccgaaaataaaata
caaatcttgaaatcaggaggctctggtcaagccttgggggaaaacaccaaagtttcagta
catgaggaattatttttggaagtcaataggatacttgcacaagaaaaatatgaatttggg
gtttatccgaagacatttgacttccttgtaaaatctgggacttgtgctcacgagatcctt
gggttgaactggctacaccagctacttcttcttggaatttacatttgggatgtccggttg
caacatattcttcaatactgtaaagctaacgctgcatctccagatagtactatccagata
aaaacaccagagaacaagccaaagaattctgaaataacttctgttcatggggacacacta
tctcttaccaacgttggaatggaaaggcaggaagcacgtatcgatacttgtcattctttt
gatagttcatttggcggtatgattttggagaatgagcagctaactgagaaatcagtaatc
caagagcctgggtcacatgttagtccagatcatcgtgaagatggtggatcatatgaagtc
gacaaatatgcacatatctctgacagtttttgtttagaaaagttaattgacttaccagtt
aagaataatgaattgccagaactagccagaggtaatgaaatgtatcctgttgccaagcca
agcaagtgttttgatatattccttaacctatttgatttcttaagtaatgatgccagaaaa
tgggtctggggtagttttagtcacctggaaaaggagtacaagaaagagcttcagggtggt
tctttggacaagtttcatctcatcaacaaatacatccccaccttttcatcactggttcag
cttaaatcccaaatggacatggtacagtttattgttggccctggtggtagtatcttgtcc
attgttgaggaagaggcatctagtatgattgcttatgcactattgatatctgagcaacaa
ggaatatattcggaagctgcaattgtaaaggatgaagttattgctggtagaaaaattgat
aaagtaacaccaatcaactcgatcggagatactcctgtgccatctgcaattttatctcca
aatgattctttagaacaagatcataacctatcaagaaatgtgtcatcgttatcatccgag
gaatcaacatctggattttatgattcttttctatctgccttaaaagatctgcatcctgaa
ttttgtttgaataatgaaaagctaactttgaagagcaaatacactgttctgtgtatatat
gcaaaacaattctacgatcttcggaagatttgttgtccatcagagattgcctatatttca
tctataagccgttgtaaagaatggaatgcacaaggtggaaagagcaaggcttttttttcg
aaatcaatggatgacagatttatcatcaaacaaattaagaagactgaatttgactcattc
ttgaagtttggccttgagtacttcaagcattttggtgtatctcaggcctcagttaacccc
acttgccttgccaaaattctgggaatatatcaggttaaggaaatcaggaatggcaaggag
gcaaggaccaatttcatggttatggaaaatcttttgtttggacgtaatataatacggaga
tatgatctgaagggtgctcttttctcacgatatgttcttgactcaaaaaatcctgagaat
gtgctattggatcaaaatttcattgaagatatgcgtgctatgcctatctacattgaaggc
aaaaccaaaaacctcttggagcgtgctatttggaatgacacggcgtttctaagtcgcatg
aatgtcatggattactccttgtttgttggagtggacaaacagaagaaggaacttgtgttt
ggaattatagattatttgaggcaatacacctgggacaaacaattggagtcttgggtgaag
acatcactttttgttcccaagaacctatctccgactgtaatttccccgaaggagtacaag
ataagattcagggcattcatgtctcagtatttcctatcagttccagatgcttga

DBGET integrated database retrieval system