KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333070
Entry
4333070           CDS       T01015                                 
Name
(RefSeq) 3beta-hydroxysteroid-dehydrogenase/decarboxylase isoform 1 isoform X1
  KO
K23558  plant 3beta-hydroxysteroid-4alpha-carboxylate 3-dehydrogenase [EC:1.1.1.418]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00100  Steroid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    4333070
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.418  plant 3beta-hydroxysteroid-4alpha-carboxylate 3-dehydrogenase (decarboxylating)
     4333070
SSDB
Motif
Pfam: 3Beta_HSD Epimerase NAD_binding_4 NAD_binding_10 GDP_Man_Dehyd Polysacc_synt_2 RmlD_sub_bind NmrA
Other DBs
NCBI-GeneID: 4333070
NCBI-ProteinID: XP_015630084
LinkDB
Position
3:16551354..16561400
AA seq 313 aa
METAPAANGCSGGRRLQEEEPAARWCAVTGGRGFMARHLVAALLRSGEWRVRITDLAPAI
TLDPVEEKGLLGEALRDGHAVYDSVNVCDITQLTKAFQGVEVVFHTAAADPDINDFQLHY
KVNVEGTKNVIDACVTCKVKRLIYTSSSGVVFDGVHGLFDVDESMPYPNKFPDAYAQSKA
EAEKLVRNSNGICELLTCSIRPGSIFGPGDTIVPHLLSHWRTMFIIGDGMNCDDFVYVEN
VVHGHICAEKTLSTKEGSKISGGKAYFITNMEPMNLWDFLYMLLEELGYKRMCEFILLRP
YLRPHTWSKFYCY
NT seq 942 nt   +upstreamnt  +downstreamnt
atggaaacggcgccggccgcgaacggttgtagtggcggccgccggctgcaggaagaagag
cccgcagctcggtggtgcgcggtgaccggtggccgcggcttcatggcgaggcacctcgtg
gcggcgctgctccgctccggcgagtggcgcgtgcggatcaccgacctcgcgccggcgatc
acccttgaccccgtcgaggagaaggggctcctcggcgaggccctccgcgacggccacgcc
gtctatgactccgtcaatgtttgcgacataacgcagttgaccaaagcttttcaaggggtg
gaagttgtttttcacacagctgctgcagaccctgacatcaacgacttccaactacattac
aaggtcaatgttgaagggacaaagaatgttattgatgcttgtgtaacgtgcaaggttaaa
aggctgatatacaccagttccagtggtgttgtatttgacggagttcatggcctttttgat
gtagatgaatcaatgccatacccaaacaagtttcctgatgcatatgcacaaagcaaggca
gaagcagagaagttagtgagaaattccaacggcatatgtgaacttctaacttgttccata
cgtcctggtagcatttttggccctggtgacaccattgtaccacatttactttcccactgg
agaacgatgtttattatcggcgatggaatgaattgtgatgattttgtatatgttgaaaat
gtggtacatggccacatttgtgctgagaaaactctctcgactaaagagggttcaaagata
agtggaggcaaggcttacttcataactaatatggagcctatgaacttgtgggactttctt
tatatgcttttagaagaacttggatataaaagaatgtgtgaattcattttgcttcgacca
tatctaagacctcatacatggagcaagttctattgctattga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333071
Entry
4333071           CDS       T01015                                 
Name
(RefSeq) 3beta-hydroxysteroid-dehydrogenase/decarboxylase isoform 1
  KO
K23558  plant 3beta-hydroxysteroid-4alpha-carboxylate 3-dehydrogenase [EC:1.1.1.418]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00100  Steroid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    4333071
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.418  plant 3beta-hydroxysteroid-4alpha-carboxylate 3-dehydrogenase (decarboxylating)
     4333071
SSDB
Motif
Pfam: 3Beta_HSD Epimerase Reticulon GDP_Man_Dehyd NAD_binding_4 RmlD_sub_bind NAD_binding_10 Polysacc_synt_2 NmrA DUF5721
Other DBs
NCBI-GeneID: 4333071
NCBI-ProteinID: XP_015633168
UniProt: Q7Y0G4 A0A0P0VZB9
LinkDB
Position
3:16571941..16577722
AA seq 561 aa
MAAAAAGGGDGRWCVVTGGRGFAARHLVAMLLRSGEWLVRVADLPPAIALDRDEEEGILG
AALREGRAAYASADLRNKAQVAAAFEGADVVFHMAAPDSSINNFHLHYSVNVEGTKNVID
ACIRCKVKRLIYTSSPSVVFDGIHGIFDADESMPYPDKFNDSYSETKADAEKLVMKANGR
DGLLTCCIRPSSIFGPGDKLLVPSLVTAARAGKSKYIIGDGSNYYDFTYVENVAYGHVCA
EKTLSSEDGAKRAAGKTYFITNMEAIKFWEFMSLILEGLGYERPSIKIPVSVMMPVAHMV
EWTYKTFARYGMKIPQLTPSRIRLLSCNRTFSCSRAKDQLGYEPIVSLKDGLKRTIESYP
HLQAQNQRSISKASIFLGNGNLAKTVLWEDMKQTMTVLLLLAVIYYHLFTCGYTFITAMA
KLFSLTALFLFIHGILPANVFGHKVEKLEPSNFHITQVEAHHIAHSVSSTWNSLVGVLKS
LCRGNDWPLFFKVVFSLLVVSILSSMSSQSAFKIGISMAFLGFKAYEKWEDTIDDLVGNA
CSVVTHFVQGQKSSRQKHADN
NT seq 1686 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcgggaggcggcgacgggagatggtgcgtggtgacgggcggccgc
ggcttcgcggcgaggcacctggtggcgatgctgctacgctccggcgagtggctggtgcgc
gtggccgacctgccccccgccatcgcgctcgaccgcgacgaggaggaggggatcctaggc
gccgccctgcgggagggccgggctgcctacgcctccgcggacctccgcaacaaggcccag
gtggccgcagcttttgagggggctgatgttgttttccacatggctgcaccagattcgtct
atcaacaactttcaccttcattattcagttaatgttgagggaacaaagaatgtcattgac
gcttgcatccgttgcaaggtgaagagacttatctacaccagttcaccaagtgtagttttc
gatggaattcatggaatctttgatgcagatgaatcaatgccttacccagacaagtttaat
gattcatattcagaaacaaaggcagatgcagaaaagttggtcatgaaggctaatggtagg
gatgggcttcttacttgttgtatacgcccaagtagcatttttggccctggtgataagcta
ctggttccttctctggttactgctgcaagggcaggaaagtctaagtacattattggtgat
gggagcaactactatgatttcacctatgtggagaatgtggcatatggccatgtttgtgca
gagaaaactctatcatctgaagatggtgcaaagagagctgctggaaaaacctatttcata
acaaatatggaggctataaaattctgggagttcatgtcgttgattttggaaggactcgga
tatgaaaggccttcaataaaaataccagtttctgttatgatgccagtggctcatatggta
gaatggacttataagacgttcgctcgctatggaatgaaaattcctcagcttactccttca
aggatccggctcctgtcttgcaatagaacattcagctgctcaagagcaaaagatcagctt
ggttatgaacccattgtgtcactcaaggatggacttaagagaacaatagagtcatatccc
catctgcaagcacaaaatcaaaggagcatatcaaaagcctcaattttccttggcaatgga
aatcttgcgaagacagttctctgggaagacatgaagcaaacaatgactgtactactgcta
ctggctgttatctactatcatttatttacatgtggttacaccttcattacagcaatggca
aagcttttctcactaaccgcactgtttttattcattcatgggattctgcctgcaaatgtg
tttggacacaaggttgagaagctcgagccttcaaattttcacatcacacaggtggaggcg
catcatattgctcattcagtcagctcaacatggaactctttagttggtgtgctaaaatct
ttatgcagaggaaatgattggccactatttttcaaggtggtattctccctattggttgtg
agcatccttagttccatgtcttcgcaatctgcatttaaaataggtatttctatggctttc
ctaggcttcaaagcctatgagaaatgggaggacaccatcgatgatttggtgggtaatgca
tgctcggttgttacgcactttgttcagggccagaaatcctcaaggcagaagcatgcagat
aattga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347580
Entry
4347580           CDS       T01015                                 
Name
(RefSeq) 3beta-hydroxysteroid-dehydrogenase/decarboxylase isoform 2
  KO
K23558  plant 3beta-hydroxysteroid-4alpha-carboxylate 3-dehydrogenase [EC:1.1.1.418]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00100  Steroid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    4347580
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.418  plant 3beta-hydroxysteroid-4alpha-carboxylate 3-dehydrogenase (decarboxylating)
     4347580
SSDB
Motif
Pfam: 3Beta_HSD Reticulon Epimerase NAD_binding_10 GDP_Man_Dehyd DUF6201 NAD_binding_4
Other DBs
NCBI-GeneID: 4347580
NCBI-ProteinID: XP_015651398
UniProt: A0A0P0XPU9 Q69IL0
LinkDB
Position
9:complement(20117440..20121728)
AA seq 570 aa
MATAEPGPGPGPRKPACCAVTFGRSTLLGRHLAAALAASGRWSTVAVLDPSPPTTTTTTS
PPPGSPLAHHHLAVDLCDPASLARALAGVEAVFHVDPTGDGSSFLQLHRLAVEGTRRLLA
ACCRSGVRTVVYTGSADVVVAGARDVVDADEDALPYPDKLGNAAIELRAQVEMMVLSADG
KNGMRTCVLRPSNMFGPGDSSLVRFVAGYARSSLGKFVVGSGANMCDFTYVENVAHANIC
AEQALCSNASSVAGKPFFVTNDEPIETWEFMSCLMEAMGCQRPKFNLPAKILSSAALFSN
MMYHKLGLQILSSPLLHPDMVYFLSCTRTLSISRARKLLGYHPIVSLEDGIMRTVGSLSE
LPDKLDLSRKRGSFGSSKAEKLLGSGITADILLWRDEKKTFSYVTVLFLLFYWFLLSDRT
FVSSAAKILLVISLALFIHGVLPPQVFGFTVEKVTSDYFEVSQETLKNTLVWMASIWNGG
IYKLRVLAEGDDWTTFLKAFAFLYCVKVMLNLQFRMLMGLVLAFMFVVFIVYEQCEEEID
SLVAFASVKVKSLVGKVIGNLPDALKAYIS
NT seq 1713 nt   +upstreamnt  +downstreamnt
atggcgaccgccgagcccggcccgggcccgggcccacgcaagcccgcctgctgcgccgtc
accttcggccgctccaccctcctcggccgccacctcgccgccgcgctcgccgcctccggc
cgctggtccaccgtcgccgtcctcgacccctctccgcccaccacaaccaccaccacctcc
ccgccgccgggctccccgctcgcccaccaccacctcgccgtcgacctctgcgaccccgcc
tccctcgcccgcgcgctcgccggggtcgaggccgtcttccacgtggaccccaccggcgac
gggtcctccttcctgcaactgcaccgcctcgccgtggagggcacgaggcggctcctcgcc
gcctgctgccggagcggcgtcaggacggtggtgtacaccggctcggccgacgtggtggtc
gccggcgcgcgggatgtggtcgacgcggacgaggacgccttgccttaccctgacaagtta
ggaaatgcagcgatcgagctgagggcgcaggtggagatgatggtgctgagtgcggatggg
aagaacggaatgcggacgtgcgtgttgcggccgagcaatatgtttgggccgggcgattcg
agcctcgtgcggttcgtcgctggatatgcgaggtcttcccttggcaagtttgtagtaggt
agtggtgctaatatgtgtgacttcacttatgtggaaaatgtggcccatgccaacatctgt
gctgagcaagctttatgttcaaacgcaagttctgttgctggaaagcccttttttgttacc
aatgatgaacctattgaaacatgggagtttatgtcttgtttgatggaagccatgggttgt
cagaggcccaagtttaatctccccgccaagatcttgtcatctgcagccttattctccaac
atgatgtatcacaagttgggtttacaaatattatcttccccacttctccatcctgacatg
gtatacttcttgtcatgcacaagaactctcagcatttcaagagctagaaagctacttggg
taccacccaatcgtatcattggaggatggcatcatgagaactgttggatcattatcagaa
ctaccagataagttggatctgtccaggaaaagaggctcttttggatcatcaaaagcagag
aagctgctaggcagtggaataactgctgatattctcctttggagggatgaaaagaaaaca
ttttcatatgtcacagtattgtttctgctgttctactggtttctgctttccgacagaact
tttgtctcgtcagctgccaaaattcttctggtgatctcgctggcacttttcatccatggc
gtgctgcctccacaagtgttcggtttcacagttgagaaggttacttctgattattttgaa
gtatcacaagaaacattgaagaatacacttgtgtggatggcttctatatggaatggaggc
atttataaattgagggttttagcagaaggcgatgactggactacgtttctaaaggcattt
gcattcttgtactgtgtgaaagtaatgttgaacttacaattcagaatgctgatgggtctt
gtactggcatttatgttcgttgttttcattgtctatgagcaatgcgaggaggaaatagac
agtttagtagcttttgcttccgtcaaagtcaaatccctagtgggaaaagtgattggaaat
ttgccggatgcgttgaaggcatacatatcttag

DBGET integrated database retrieval system