KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333117
Entry
4333117           CDS       T01015                                 
Name
(RefSeq) probable 6-phosphogluconolactonase 1 isoform X1
  KO
K01057  6-phosphogluconolactonase [EC:3.1.1.31]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00030  Pentose phosphate pathway
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
osa_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    4333117
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     4333117
SSDB
Motif
Pfam: Glucosamine_iso
Other DBs
NCBI-GeneID: 4333117
NCBI-ProteinID: XP_015628257
UniProt: Q75IV7
LinkDB
Position
3:complement(17288043..17293117)
AA seq 296 aa
MLSWNNSWHSSSTENRTMEREIVASYEPKKNNEIRMFESSDEMATDLAEYISQVSEISIK
ERGYFAIALSGGPLISFMRKLCEAPYNKTLDWSKWYIFWADERAVAKNHVDSYYKSTKED
FLSKVPILNGHVYSINDNVTVEDAATDYEFVIRQLVKIRTVGVSESNDCPKFDLILLSIG
SDGHVASLFPNHPALELKDDWVTYITDSPVPPPERITFTLPVINSASNIAVVATGEDKAK
AVYFAISDGTEGPDAPSIPARMVQPTDGKLVWFLDKASASFLEAKTKNDGYEHPKY
NT seq 891 nt   +upstreamnt  +downstreamnt
atgctcagttggaataatagctggcattcaagttcaacagaaaatagaacaatggagagg
gaaattgtggcctcatatgaacccaagaagaataacgaaatcaggatgtttgagagttca
gacgagatggcaacagatctggctgagtatatttcacaagtttcagaaatttctattaag
gaaagaggttactttgctattgccctgtctggagggcctcttatcagttttatgcggaaa
ctttgtgaagcaccatacaacaaaaccctggattggtctaaatggtacatcttctgggct
gatgaacgtgcggtggctaagaaccatgtggatagctactataaatcaacaaaagaagat
tttctctccaaggtgcctattcttaatggtcacgtctactccatcaatgacaatgtgacg
gtggaggatgcagcgacggactacgaattcgtcatccgtcagctggtcaagattcgcaca
gtcggagtttcagagagcaacgactgccccaagtttgatctgatcctccttagcatcggc
tctgatggtcatgtagcctcattgttccccaaccatcctgcacttgagctcaaggacgac
tgggtcacctacatcaccgactctccggtgccgccaccggagaggatcaccttcaccctt
cccgtgataaactcggcatcgaacatcgccgtagtggccaccggagaagacaaggcaaag
gctgtgtattttgccatctctgacggtacagagggtcctgatgctccatcaattcctgca
agaatggttcagccaacggacggtaagttggtttggtttttggacaaggcgagtgcctcg
tttcttgaggccaagaccaagaacgatgggtatgagcatccaaagtattag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343843
Entry
4343843           CDS       T01015                                 
Name
(RefSeq) probable 6-phosphogluconolactonase 2
  KO
K01057  6-phosphogluconolactonase [EC:3.1.1.31]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00030  Pentose phosphate pathway
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
osa_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    4343843
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     4343843
SSDB
Motif
Pfam: Glucosamine_iso
Other DBs
NCBI-GeneID: 4343843
NCBI-ProteinID: XP_015647667
UniProt: Q6Z4H0
LinkDB
Position
7:24736930..24742155
AA seq 280 aa
MEREISALYEPKRNNEIRIFESSDEMSTDLAEYISQVSEISVKERGYFAIALSGGPLVSF
LGKLCEAPYNKTLDWSKWYIFWSDERAVAKNHAESNYRITKEGFLSKVPILNGHVYSIND
NATVEDAATDYEFVIRQLVKVRTIGVSESNDCPKFDLILLSMGSDGHVASLFPNHPSLEL
KDDWITYITDSPQPPPERITFTLPVINSASNIAIVTTGDDKSEAVHLAISDNADGPEAPS
SLPARMVQPTDGKLVWFLDKSAASSLDAENDDAFEQHREY
NT seq 843 nt   +upstreamnt  +downstreamnt
atggagagggaaatttctgccttatatgaaccaaaaagaaacaatgaaataagaattttt
gagagttcagatgagatgtcaacagatctggctgagtatatctcgcaagtttcagaaata
tctgtcaaagaaaggggatactttgctattgccctttctggaggtcccctagtcagtttt
ttggggaaactttgtgaagcgccatacaacaagaccttggattggtctaaatggtacatc
ttctggtctgatgagcgtgctgtagcaaagaatcatgcagagagtaattataggataaca
aaagaaggattcctgtccaaggtacctattctcaatggccatgtctactctataaacgac
aacgcgacggtggaggatgccgcaacagattacgaatttgtcatcaggcagctggtcaag
gtccgcactattggagtctccgaaagcaacgattgccccaagttcgatctaatcctgctc
agcatgggttctgatggacatgtggcttcattgttccccaaccatccatcccttgagctg
aaagatgactggatcacctacatcaccgactctccccagcctccacctgagcggatcacc
ttcactctccctgtgataaactcggcttcgaacatcgcaatagtgactaccggtgacgat
aaatcggaggctgtccatttggccatttctgacaatgcagatggtccagaagccccctca
tcgctgccagcaagaatggttcagccaacagacggcaagctggtgtggtttttggacaag
tcagctgcgtcctctctggatgccgagaacgatgacgcctttgagcagcatcgcgagtac
taa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346232
Entry
4346232           CDS       T01015                                 
Name
(RefSeq) probable 6-phosphogluconolactonase 3, chloroplastic
  KO
K01057  6-phosphogluconolactonase [EC:3.1.1.31]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00030  Pentose phosphate pathway
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
osa_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    4346232
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     4346232
SSDB
Motif
Pfam: Glucosamine_iso
Other DBs
NCBI-GeneID: 4346232
NCBI-ProteinID: XP_015648445
LinkDB
Position
8:27403407..27406438
AA seq 424 aa
MEHTPLTPEITLEQALANKGKEKNIKMAFSLHFPRHHGAGDTCPHRERGGANGERDPAVH
RDLDGIKWSTSPHPLVPFPFVPPSPAAAAAAVAVDASMSASAAVSSTCAAASSTTSRRSS
SSPASRVQATPRRSLPSRLVASRTSPRSPVVPPVYATASPGGAGGTTAAAARKKLLIFDA
EEYLAESLAKYTARLSGEAVAERGAFTVALSGGSLIKALRKLTESPYLEAVEWSKWHVFW
VDERVVPKDHADSNYKLAMDGLLSKVPIPASQIYAINDTLSAEGAADEYETCLKQLVNDG
VVAISEVTGFPKLDLMLLGMGPDGHVASLFPGHPVVNENLKWVSYIKDSPKPPPERITFT
FPLVNSSAHIALVVTGAGKAGAVHKAFSDKQSSSDLLPVEMVSQQEGVLTWFTDKPAVSM
LSSI
NT seq 1275 nt   +upstreamnt  +downstreamnt
atggaacatacaccactaacacctgaaattacactagaacaagcactagcaaataagggg
aaggagaaaaatataaaaatggcgttttctctccattttccacgtcatcatggtgcggga
gacacgtgtccacatcgagagagaggcggagcaaacggtgagcgcgatccagccgtccat
cgcgatctggacggtataaagtggtccacctctccccatccactcgtccctttcccgttc
gttccaccttcccccgccgccgccgccgccgccgtcgccgtcgacgccagcatgtccgcc
tccgccgccgtctcctccacctgcgccgcggcctcctcgacgacctcccgccgctcgtcg
tcgtctccggcgtccagggttcaggcgacaccccgtcggtctctaccctcccggctcgta
gcatcccggacctccccacgctctcccgtcgtgccgccggtctacgccacggcctcaccg
ggcggcgccggtgggacgacggcggcggcggcgaggaagaagctgctcatattcgatgcc
gaggagtacctcgcggagtctctggccaagtacacggcgcggctctccggggaggccgtc
gcggagaggggcgcgttcaccgtcgcgctctccggtggctcgctcatcaaggccctcagg
aagttgacggagtcgccgtacctggaggcggtggaatggagcaaatggcatgtgttctgg
gtggacgagagggtggtgcccaaggaccacgcagatagcaactacaaactcgccatggat
gggttgctttctaaggtgccaattcctgcaagccaaatctatgccataaacgacacacta
tcagctgaaggggctgcagatgaatatgaaacttgtctaaagcaactagttaatgatggt
gtggttgcaatatcagaagtaactggattccccaagcttgatcttatgcttctggggatg
ggccctgatgggcatgttgcctctcttttccccggtcatccggttgtcaatgaaaaccta
aagtgggtcagctacatcaaggattcacccaagccaccaccagagcgaataacatttact
ttccccttagtcaattcgtcggcacatatcgcacttgtggtcactggtgctgggaaagct
ggggcagtgcataaggcattctcagataagcaaagctcttcagacttgctgcctgttgag
atggtttcacagcaagagggagtgctcacttggttcactgacaaaccagcagtgtcaatg
ctgtccagcatctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347654
Entry
4347654           CDS       T01015                                 
Name
(RefSeq) probable 6-phosphogluconolactonase 4, chloroplastic
  KO
K01057  6-phosphogluconolactonase [EC:3.1.1.31]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00030  Pentose phosphate pathway
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
osa_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    4347654
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     4347654
SSDB
Motif
Pfam: Glucosamine_iso
Other DBs
NCBI-GeneID: 4347654
NCBI-ProteinID: XP_015612582
UniProt: Q69NG5
LinkDB
Position
9:complement(20724870..20727999)
AA seq 324 aa
MSVSAAVAAASTSRTLVLARHRSPPASRVAATSRGRPFSSGPHPLAVSPATRAPAMATDG
AAAAAAAGSKKKKEVLIFDAEEDLAVSLAKYTAELSAKLAAERGAFTVVLSGGSLIKNIR
KLAEPPYLDSVDWSKWHVFWVDERVVPKDHEDSNYKLALDGFLSKVPIPTGQVYAINDAL
SAEGAADDYETCLKQLVKNGVIAMSQSTGFPRFDVMLLGMGPDGHIASLFPGHPLVNENK
KWVTYIKDSPKPPPERITFTFPVINSSAYVAMVVTGAGKAGAVQKALSDKQTSSDLLPVE
MAVLQDGEFTWFTDKPAVSMLQNK
NT seq 975 nt   +upstreamnt  +downstreamnt
atgtccgtctccgccgccgtcgccgccgcctccacctcccgtaccctcgtcctcgcccgc
caccgctcgccgccggcgtctagggtcgcggcgacaagccgcgggcgtccgttctcctcc
ggcccccatcccctcgccgtctctcccgccacccgcgcccccgccatggccaccgacggc
gccgccgccgccgccgcggcagggtcgaagaagaagaaggaggtgctcatcttcgacgcc
gaggaggacctcgcggtgtccctggcgaagtacacggcggagctgtccgcgaagctcgcc
gccgagaggggcgccttcaccgtcgtgctctccggcggatccctcatcaagaacatcagg
aagctcgcggagccaccgtacctggattcggtggattggagcaagtggcatgtgttctgg
gtggacgagagggtggtgcccaaggaccatgaggatagcaactacaagctcgccttggat
gggtttctctccaaggtcccaattcctactggccaagtttatgctataaatgatgccttg
tcagctgagggagcagcggatgactatgaaacttgcttgaagcaacttgtcaagaatggt
gtgattgcaatgtcgcaatcgactgggtttcctaggtttgatgtcatgctcctgggaatg
ggccctgatggccatattgcatctcttttcccaggccaccctcttgttaatgaaaacaag
aagtgggtcacctacatcaaggattctccaaagccaccacctgagagaattacgtttaca
tttcctgtgatcaactcatctgcgtatgtcgcaatggtggtcactggagctgggaaagct
ggtgcagtgcagaaagcactttcagataagcagacttcgtctgatttgctgcctgtagaa
atggctgtacttcaagatggggaattcacttggttcactgacaagccagcagtgtcaatg
ttacagaacaaatga

DBGET integrated database retrieval system