KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333153
Entry
4333153           CDS       T01015                                 
Name
(RefSeq) probable uridine nucleosidase 2
  KO
K01240  uridine nucleosidase [EC:3.2.2.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00240  Pyrimidine metabolism
osa00760  Nicotinate and nicotinamide metabolism
osa01100  Metabolic pathways
osa01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    4333153
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    4333153
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.3  uridine nucleosidase
     4333153
SSDB
Motif
Pfam: IU_nuc_hydro
Other DBs
NCBI-GeneID: 4333153
NCBI-ProteinID: XP_015633336
UniProt: B9F944 Q84MH2
LinkDB
Position
3:complement(17745385..17748556)
AA seq 322 aa
MTTTKKKLVIDTDPGIDDAMAIFVALRSPEVELLGLTTIFGNVYTTLATRNALHLLEAVG
RTDIPVAEGSHVTIKKATKLRIASFVHGSDGLGNQNFPPPTGKPLDQSAAAFLVEQANLY
PGQVTVVALGPLTNLALAIELDPSFPKKIGQIVILGGAYSVNGNVNPAAEANIFGDPDAA
DIVFTSGADILAVGINITHQVVLSDADREKLEQSDSKYARYLSKILGLYYDYHKDAYFIK
GVYLHDPATLIAAVDPSLMTYTEGVVRVQTDGITKGLTVFDTTKKRYGEITAWTGKPTVK
VAVTVDAPAVVEMIMQRLTTDD
NT seq 969 nt   +upstreamnt  +downstreamnt
atgacgacgacgaagaagaagctcgtcatcgacaccgacccgggaatcgatgacgccatg
gccatcttcgtggcgctgaggtcgccggaggtggagctgctgggcctcaccaccatcttc
ggcaacgtctacaccaccctcgccacccgcaacgccctccacctgctggaggctgttggg
aggactgacatccccgtggcagagggatcccatgtaacaatcaagaaagccaccaagcta
cggattgcgagctttgttcatggctcggatggtctaggaaatcagaactttcctccgcca
actgggaagcccttagatcaatcggccgccgcgtttcttgtcgagcaggcaaatctgtac
cctggacaagttactgtggttgcccttggtccacttaccaacctagctttggctatagaa
cttgatccttctttcccgaagaagattgggcagattgtgatccttggtggtgcgtattca
gttaatggaaatgtcaaccctgcagctgaggcaaatatatttggtgaccctgatgcagct
gatatagttttcacctccggtgctgatattttggctgtgggaataaatattacacaccaa
gtagttctttctgatgctgaccgggaaaagcttgaacagtctgatagcaaatatgcccga
tacttgagcaagatcctgggtctttattatgattaccacaaggacgcctacttcataaaa
ggagtgtatcttcacgatccagcaacacttattgctgcggtagatccgtcactgatgact
tacacggaaggtgtagtgagggtgcagactgatggcatcacaaagggtctcacagttttc
gacacaaccaagaaaaggtatggggagataactgcgtggaccggtaagccaaccgtgaag
gttgctgtgaccgttgatgctcctgccgttgtggagatgatcatgcagaggcttacgacg
gatgattag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346302
Entry
4346302           CDS       T01015                                 
Name
(RefSeq) probable uridine nucleosidase 1 isoform X1
  KO
K01240  uridine nucleosidase [EC:3.2.2.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00240  Pyrimidine metabolism
osa00760  Nicotinate and nicotinamide metabolism
osa01100  Metabolic pathways
osa01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    4346302
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    4346302
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.3  uridine nucleosidase
     4346302
SSDB
Motif
Pfam: IU_nuc_hydro
Other DBs
NCBI-GeneID: 4346302
NCBI-ProteinID: XP_015650264
UniProt: Q6ZJ05
LinkDB
Position
8:complement(27922847..27926809)
AA seq 324 aa
MGSNEQIHRDKLIIDTDPGIDDSMTILMAFRAPTVEIIGLTTIFGNTTTKNATQNALLLC
ERAGHPEVPVAEGSAEPLKGGEPRVADFVHGSDGLGNLFLPAPTSKKVDENAAEFMVNKV
SQFPGEVSILALGPLTNVALAIKRDPSFASKVKKIVVLGGAFFAAGNVSPAAEANIYGDP
EAADIVFTSGADVDVVGINITTQVCFTDEDLLELRNSKGKHAQFLCDMCQFYRDWHAESD
GFHGIFLHDPVSFTALVHPEYFTFKKGVVRVETQGICTGHTLMDQGLKKWNSENPWSGYK
PISVAWTVDVPNVLAFVKELLMAP
NT seq 975 nt   +upstreamnt  +downstreamnt
atggggtcgaacgagcagatccaccgggacaagctcatcatcgacacggatcccggcatc
gatgatagcatgacaatccttatggcgttcagagctccaactgtggagatcatagggctc
acaaccatatttggcaacaccaccacaaagaatgcgactcagaatgcgctcttgctgtgt
gagagagcaggacatcctgaggttccagtagcagagggcagcgcagagcctctcaaggga
ggagagccacgtgttgctgactttgttcatgggtctgatggcctggggaatttgtttctt
cctgcacccactagtaagaaggttgatgaaaatgctgctgagttcatggttaataaggtc
tctcaatttcctggagaagtttctatactcgcattgggacccctgacaaacgtggcgctg
gccatcaaaagggacccttcctttgcaagtaaggtgaagaaaatagttgtactgggtggt
gctttctttgcggctggaaatgtcagcccagctgctgaagcaaatatatatggagatcca
gaagcagctgacatagtttttacctcaggagcagatgttgacgtggttggcattaacata
acaactcaagtctgttttacagatgaggatctcctggagctaagaaactcaaaagggaag
catgcacagttcttatgtgacatgtgccagttctatagagactggcatgccgaatccgat
ggctttcatggaattttcctccatgatcctgtgagcttcactgccctagttcaccctgag
tacttcacgttcaagaagggtgttgtgagagtagaaacccagggcatttgcactggtcac
actttaatggaccaaggattgaaaaagtggaattcagagaatccatggtctggctacaag
ccaatctcagttgcatggacagttgatgtgccaaatgttctcgcattcgtgaaggaactc
ctcatggctccatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347891
Entry
4347891           CDS       T01015                                 
Name
(RefSeq) probable uridine nucleosidase 2
  KO
K01240  uridine nucleosidase [EC:3.2.2.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00240  Pyrimidine metabolism
osa00760  Nicotinate and nicotinamide metabolism
osa01100  Metabolic pathways
osa01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    4347891
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    4347891
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.3  uridine nucleosidase
     4347891
SSDB
Motif
Pfam: IU_nuc_hydro NifU
Other DBs
NCBI-GeneID: 4347891
NCBI-ProteinID: XP_015610747
UniProt: Q652Q8
LinkDB
Position
9:complement(22677593..22680370)
AA seq 337 aa
MDLQEAAMEARNGHRIPPTEEKVIIDTDPGIDDSVAIMMAFEAPGVKVVGLTTIFGNCTT
SHATRNALILCDRAGRPEVPVAEGSAEPLKGGKPHVADFVHGSDGLGNTSFPDPTTTNKV
EQSAAEFLVDKVSESPGEISVLALGPLTNIALAMKKDSSFASKVKRIVVLGGAFFAAGNA
TPSAEANIHSDPEAADIVFTSGADIYVVGLNITTQVYFTDKDMLELRNSKGKHAQFLCDI
CKFYRDWHVHSYGVDALFLHDPVSFTALVHPEYFTFKKGVVRVETQGICKGHTSMDMGLK
KWNSDNPWTGYSPISVAWTVDVPKVLAYAKELLFNAQ
NT seq 1014 nt   +upstreamnt  +downstreamnt
atggatctgcaggaggcggcgatggaagccaggaacggccatcggatcccgccgacggag
gagaaggtcatcatcgacacggatccagggatcgatgacagcgtggcgatcatgatggcg
ttcgaagctcccggcgtgaaggtcgtcggactcaccaccatcttcggcaactgcactacc
tcccacgccacccgcaatgccctcatcctgtgcgacagagcaggccgtcctgaggtgccg
gtagcagagggcagcgctgagcctctcaagggagggaaacctcacgttgctgattttgtt
catggatcggatggacttggtaacacgtcctttcctgatcctaccaccaccaacaaagtt
gagcagtcagctgcagagtttctggttgataaggtatcagaatctccaggagagatctct
gtactcgccttgggccctctcactaatatcgcattggccatgaagaaagactcctccttt
gcaagcaaggttaagaggatagttgtgctgggtggagctttctttgcagctgggaatgcc
accccttcagctgaagcaaatatccatagcgacccagaagcagctgacatagttttcact
tctggggcagatatctacgtagttggccttaacataacaacccaagtctacttcacagac
aaggatatgttggagctaaggaactcgaaagggaagcacgcacaattcctttgtgacatc
tgcaagttctacagagactggcatgtccactcctacggcgtcgatgctctttttctccat
gatcctgtgagtttcaccgcgctagttcaccccgagtacttcacgttcaagaagggcgtg
gtgagggttgagacccagggcatctgcaaggggcatacttccatggacatgggactgaag
aagtggaattcagacaacccgtggactggttactctccgatctcggttgcttggactgtt
gatgttcctaaggttctggcatatgccaaggagctactcttcaacgcacaatga

DBGET integrated database retrieval system