KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333156
Entry
4333156           CDS       T01015                                 
Name
(RefSeq) UDP-glucose 6-dehydrogenase 1
  KO
K00012  UDPglucose 6-dehydrogenase [EC:1.1.1.22]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00040  Pentose and glucuronate interconversions
osa00053  Ascorbate and aldarate metabolism
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01240  Biosynthesis of cofactors
osa01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    4333156
   00053 Ascorbate and aldarate metabolism
    4333156
   00520 Amino sugar and nucleotide sugar metabolism
    4333156
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.22  UDP-glucose 6-dehydrogenase
     4333156
SSDB
Motif
Pfam: UDPG_MGDP_dh_N UDPG_MGDP_dh_C UDPG_MGDP_dh NAD_binding_2 Sacchrp_dh_NADP
Other DBs
NCBI-GeneID: 4333156
NCBI-ProteinID: XP_015630087
UniProt: Q75GS4
LinkDB
Position
3:17772910..17776460
AA seq 481 aa
MVKICCLGAGYVGGPTMAVIALKCPDVEVVVVDISAARIDAWNSDALPIYEPGLDDVVRR
CRGRNLFFSSDVERHVGEADIVFVSVNTPTKARGLGAGKAADLTYWESAARMIAAVATSD
KVVVEKSTVPVKTAEAIEKILDHNGRDGVGFQILSNPEFLAEGTAIRDLLAPDRVLIGGR
ETAAGRAAVQALKDVYTRWVPEERILTTNLWSAELSKLAANAFLAQRISSVNAMSALCEA
TGADVAEVAYAVGKDSRIGAKFLNASVGFGGSCFQKDILNLVYICECNGLPEVANYWKQV
IKINDYQKSRFVNRVVSSMFNTVAGKKIAVLGFAFKKDTGDTRETPAIDVCKGLIGDKAK
VSIYDPQVTEDQVQRDLAMSKFDWDHPVHLQPMSPTAIKQVSVAWDAYEAARAAHGVCIL
TEWDEFRSLDYARIYGGMQKPAFVFDGRNVVDAEKLREIGFIVYSIGKPLDAWLKDMPAV
A
NT seq 1446 nt   +upstreamnt  +downstreamnt
atggtgaagatctgctgcctcggagccggctatgtcggcggcccgaccatggcggtcatc
gccctcaagtgccccgacgtcgaggtggtcgtcgtcgacatctccgccgcccgcatcgac
gcctggaacagcgacgcgctcccgatctacgagccgggcctcgacgacgtcgtgcgccgc
tgccgcgggaggaacctcttcttcagcagcgacgtcgagaggcacgtcggcgaggccgac
atcgtcttcgtctccgtgaacacccccaccaaggcccgcggcctcggcgccggcaaggcc
gccgacctcacctactgggagagcgcggcgcggatgatcgccgccgtggcgacgtccgac
aaggtcgtcgtcgagaagtccaccgtgccggtcaagaccgcggaggccatcgagaagatc
ctcgaccacaacggccgcgacggcgtcggcttccagatcctctccaacccggagttcctc
gccgagggcaccgccatccgcgacctgctcgcccccgaccgcgtcctcatcggcggccgc
gagaccgccgcggggcgcgccgccgtccaggcgctcaaggacgtgtacacccgatgggtc
cccgaggagaggatcctcaccaccaacctctggtccgccgagctgtccaagctcgccgcc
aacgcgttcctggcccagaggatctcgtccgtcaacgccatgtccgcgctctgcgaggcc
accggcgccgacgtcgccgaggtcgcctacgccgtgggcaaggactccaggatcggcgcc
aagtttctcaacgccagcgtgggattcggtggctcctgcttccagaaagacatcctcaac
ctggtgtacatctgcgagtgcaatggcctccccgaggtggccaactactggaagcaggtt
atcaagatcaacgactaccagaagagccggttcgtgaaccgcgtggtgtcgtccatgttc
aacaccgtggccggcaagaagatcgccgtgctgggcttcgccttcaagaaggacaccggc
gacaccagggagacgcccgccatcgacgtctgcaaggggctgatcggcgacaaggccaag
gtgagcatctacgacccccaggtgacggaggaccaggtccagcgcgacctcgccatgagc
aagttcgattgggatcacccggtccatctccagccgatgagccccacggccatcaagcag
gtgtccgtcgcctgggacgcctacgaggcggccagggccgcccacggcgtctgcatcctc
actgagtgggacgagttcaggagcctcgactacgcgaggatctacgggggaatgcagaag
ccggcgttcgtgttcgacgggcgcaacgtggttgacgctgagaagctgagggagattgga
ttcatcgtctactccattggcaagcctctcgatgcctggctcaaggacatgcctgctgtt
gcctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333410
Entry
4333410           CDS       T01015                                 
Name
(RefSeq) UDP-glucose 6-dehydrogenase 2
  KO
K00012  UDPglucose 6-dehydrogenase [EC:1.1.1.22]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00040  Pentose and glucuronate interconversions
osa00053  Ascorbate and aldarate metabolism
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01240  Biosynthesis of cofactors
osa01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    4333410
   00053 Ascorbate and aldarate metabolism
    4333410
   00520 Amino sugar and nucleotide sugar metabolism
    4333410
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.22  UDP-glucose 6-dehydrogenase
     4333410
SSDB
Motif
Pfam: UDPG_MGDP_dh_N UDPG_MGDP_dh_C UDPG_MGDP_dh NAD_binding_2
Other DBs
NCBI-GeneID: 4333410
NCBI-ProteinID: XP_015629261
UniProt: B7F958
LinkDB
Position
3:complement(22641454..22657252)
AA seq 482 aa
MVKICCIGAGYVGGPTMAVIALKCPDVEVVVVDISAPRIEGWNSERLPIYEPGLDDVVRQ
CRGRNLFFSTDVERHVADAGIVFVSVNTPTKTRGLGAGKAADLTYWESAARIIADVSRSD
KIVVEKSTVPVKTAEAIEKILAHNSKGGNIRYQILSNPEFLAEGTAIQDLFSPDRVLIGG
RETPEGRAAVAALKSIYARWVPDDRIITTNLWSAELSKLAANAFLAQRISSVNAISALCE
ATGADVTEVANSIGKDSRIGPRFLSASVGFGGSCFQKDILNLVYICECYGLPEVANYWHQ
VIRINDYQKSRFVNRVVSSMFNTVAGKKVAVLGFAFKKDTGDTRETPAIDVCKGLVGDKA
VVSIYDPQVTEEQVQRDLVMNKFDWDHPRHLQPMSPSSAKHVAVSWDAYEAARGAHAVCI
LTEWDEFRRLDYQRMYDAMHKPAFLFDGRNVVDPDKLRRIGFVVYSIGKPLDHWLRDMPA
VA
NT seq 1449 nt   +upstreamnt  +downstreamnt
atggtgaagatctgctgcatcggggcggggtacgtgggcggcccgacgatggcggtgatc
gcgctcaagtgccccgacgtggaggtggtggtggtggacatctcggcgccgcggatcgag
gggtggaacagcgagcgcctccccatctacgagcccggcctggacgatgtcgtcaggcag
tgccgcggccgcaacctcttcttcagcaccgacgtcgagcgccacgtcgccgacgccggc
atcgtcttcgtctccgtcaacacccccaccaagacccgcggcctcggcgccgggaaggcc
gccgacctcacctactgggagagcgccgcccgcatcatcgccgacgtctcccgctccgac
aagatcgtcgtcgagaagtccaccgtccccgtcaagaccgccgaggccatcgagaagatc
ctcgcccacaacagcaagggcggcaacatcaggtaccagatcctctccaacccggagttc
ctcgccgagggcaccgccatccaggacctcttctccccggaccgcgtcctcatcggcggc
cgcgagacgcccgagggccgcgccgccgtcgccgccctcaagtccatctacgcccgctgg
gtccccgacgaccgcatcatcaccaccaacctctggtccgccgagctgtccaagctcgcc
gccaacgccttcctggcgcagcgcatctcctccgtcaacgccatctccgcgctgtgcgag
gccaccggcgccgacgtcacggaggtggccaactccatcggcaaagactcgcggatcggg
ccgaggttcctctccgcgagcgtcggcttcggcggctcctgcttccagaaggacatcctc
aacctggtgtacatctgcgagtgctacggcttgccggaggtggccaactactggcaccag
gtgatccggatcaacgactaccagaagagccgcttcgtgaaccgggtggtgtcctccatg
ttcaacacggtggccggcaagaaggtggccgtgctgggcttcgcgttcaagaaggacacc
ggcgacacgagggagacgccggcgatcgacgtctgcaaggggctcgtcggcgacaaggcg
gtggtcagcatctacgacccgcaggtgacggaggagcaggtgcagcgcgacctagtgatg
aacaagttcgactgggaccacccgcgccacctgcagccgatgagcccgtcgtcggcgaag
cacgtcgccgtgtcgtgggacgcctacgaggcggcgcgcggcgcgcacgccgtctgcatc
ctcaccgagtgggacgagttccgccggctcgactaccagcggatgtacgacgccatgcac
aagccggccttcctcttcgacggccgcaacgtcgtcgacccggacaagctccgccgcatc
ggcttcgtcgtctactccatcggcaagccgctcgaccactggctcagggacatgcccgcc
gtcgcctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334169
Entry
4334169           CDS       T01015                                 
Name
(RefSeq) UDP-glucose 6-dehydrogenase 3
  KO
K00012  UDPglucose 6-dehydrogenase [EC:1.1.1.22]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00040  Pentose and glucuronate interconversions
osa00053  Ascorbate and aldarate metabolism
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01240  Biosynthesis of cofactors
osa01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    4334169
   00053 Ascorbate and aldarate metabolism
    4334169
   00520 Amino sugar and nucleotide sugar metabolism
    4334169
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.22  UDP-glucose 6-dehydrogenase
     4334169
SSDB
Motif
Pfam: UDPG_MGDP_dh_N UDPG_MGDP_dh_C UDPG_MGDP_dh NAD_binding_2 TEX12 Sacchrp_dh_NADP
Other DBs
NCBI-GeneID: 4334169
NCBI-ProteinID: XP_015631440
UniProt: Q9AUV6
LinkDB
Position
3:31315795..31318378
AA seq 480 aa
MVKICCIGAGYVGGPTMAVIALKCPAIEVVVVDISKPRIDAWNSEQLPIYEPGLDEVVKE
CRGRNLFFSTDVEKHVAEADIIFVSVNTPTKTRGLGAGKAADLTYWESAARMIADVSKSD
KIVVEKSTVPVKTAEAIEKILTHNSKGINYQILSNPEFLAEGTAIDDLFKPDRVLIGGRE
TAEGRKAVQALKSVYAHWVPEDRIITTNLWSAELSKLAANAFLAQRISSVNAISALCEAT
GANVTEVAYAVGKDSRIGPKFLNASVGFGGSCFQKDILNLVYICECNGLPEVANYWKQVI
KINDYQKSRFVNRVVSSMFNTVSGKKIAVLGFAFKKDTGDTRETPAIDVCHGLLGDKAQI
SIYDPQVTEDQIQRDLAMGKFDWDHPMHLQPTSPTAFKQVSVVWDAYEATKNAHGLCILT
EWDEFKTLDYQKIYDNMQKPAFVFDGRNVVDPEKLREIGFIVYSIGKPLDAWLKDMPAVA
NT seq 1443 nt   +upstreamnt  +downstreamnt
atggtgaagatctgctgcatcggagctgggtacgtgggcgggccgaccatggcggtgatc
gccctcaagtgcccggcgatcgaggtggtggtcgtcgacatctccaagccgcgcatcgac
gcctggaacagcgagcagctgccgatctacgagccggggctcgacgaggtggtcaaggag
tgcaggggcaggaacctcttcttcagcacggacgtcgagaagcacgtcgcggaggcggac
atcatcttcgtgtccgtgaacacgccgaccaagacgcgcggcctcggcgccggcaaggcg
gccgacctcacctactgggagagcgcggcgaggatgatcgccgacgtgtccaagtccgac
aagatcgtcgtcgagaagtccaccgtgccggtcaagacggccgaggcgatcgagaagatc
ctgacgcacaacagcaagggcatcaactaccagatcctctccaacccggagttcctcgcc
gagggcaccgctattgacgacctgttcaagcccgaccgcgtcctcatcggcggccgcgag
acggcggaggggaggaaggccgtgcaggcgctcaagtcggtgtacgcgcactgggtgccc
gaggacaggatcatcaccaccaacctctggtccgccgagctctccaagctcgccgcgaac
gcgttcctggcgcagaggatctcgtcggtgaacgccatctcggcgctctgcgaggccacc
ggcgcgaacgtcaccgaggtggcgtacgccgtcggcaaggactcgaggattggccccaaa
ttcctcaacgccagcgttggattcggcggctcctgcttccagaaggacatcctgaatctg
gtgtacatctgcgaatgcaatggcctccccgaggttgcgaactactggaagcaggtgatc
aagatcaacgactaccagaagagccggttcgtgaaccgggtggtgtcgtccatgttcaac
acggtgtcgggcaagaagatcgccgtgctggggttcgcgttcaagaaggacaccggcgac
acgagggagacgccggcgatcgacgtgtgccacggcctgctcggcgacaaggcgcagatc
agcatctacgacccgcaggtgacggaggaccagatccagcgggacctcgccatgggcaag
ttcgactgggaccacccgatgcacctgcagccgacgagccccacggcgttcaagcaggtg
agcgtggtgtgggacgcgtacgaggccaccaagaacgcccatggcctctgcatcctcacc
gagtgggacgagttcaagacgctcgactaccagaagatctacgacaacatgcagaagccg
gcgttcgtcttcgacggccgcaacgtcgtcgacccggagaagctcagggagatcggcttc
atcgtctactccatcggcaagccgctcgacgcctggctcaaggacatgcccgccgtggca
tga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352146
Entry
4352146           CDS       T01015                                 
Name
(RefSeq) UDP-glucose 6-dehydrogenase 4
  KO
K00012  UDPglucose 6-dehydrogenase [EC:1.1.1.22]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00040  Pentose and glucuronate interconversions
osa00053  Ascorbate and aldarate metabolism
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01240  Biosynthesis of cofactors
osa01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    4352146
   00053 Ascorbate and aldarate metabolism
    4352146
   00520 Amino sugar and nucleotide sugar metabolism
    4352146
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.22  UDP-glucose 6-dehydrogenase
     4352146
SSDB
Motif
Pfam: UDPG_MGDP_dh_N UDPG_MGDP_dh_C UDPG_MGDP_dh NAD_binding_2 TEX12 Sacchrp_dh_NADP
Other DBs
NCBI-GeneID: 4352146
NCBI-ProteinID: XP_015620155
UniProt: Q2QS14
LinkDB
Position
12:14887816..14890477
AA seq 480 aa
MVKICCIGAGYVGGPTMAVIALKCPAIEVVVVDISKPRIDAWNSEQLPIYEPGLDEVVKE
CRGRNLFFSTDVEKHVAEANIIFVSVNTPTKTRGLGAGKAADLTYWESAARMIADVSKSD
KIVVEKSTVPVKTAEAIEKILTHNSKGINYQILSNPEFLAEGTAIEDLFKPDRVLIGGRE
TPEGKKAVQALKEVYAHWVPEDRIITTNLWSAELSKLAANAFLAQRISSVNAISALCEAT
GANVAEVAYSVGKDSRIGPKFLNASVGFGGSCFQKDILNLVYICECNGLPEVANYWKQVI
KINDYQKSRFVNRVVSSMFNTVSGKKIAVLGFAFKKDTGDTRETPAIDVCHGLLGDKAQI
SIYDPQVTEDQIQRDLAMSKFDWDHPMHLQPTSPTAFKQVSVVWDAYEATKGAHGVCILT
EWDEFKTLDYQKIFDNMQKPAFVFDGRNVVDAEKLREIGFIVYSIGKPLDAWLKDMPAVA
NT seq 1443 nt   +upstreamnt  +downstreamnt
atggtgaagatctgctgcattggagctggctatgtcggcggcccaaccatggccgtcatt
gccctcaaatgcccagcaatcgaggtggtggttgttgacatttccaagcctcgcattgat
gcctggaacagcgaacagctcccgatctacgagcctggcctcgatgaggtcgtgaaggag
tgcagaggcaggaacctcttcttcagcactgatgtggagaagcatgtcgccgaggcgaac
atcatctttgtatctgtcaacacccccaccaagacccgtggtcttggagcaggcaaggct
gctgacctcacctactgggaaagtgctgctcggatgattgctgatgtctccaagtctgac
aagatcgttgttgagaagtccactgtccctgtcaagactgcagaggccattgagaagatc
ttgacccacaacagcaagggcatcaactaccagatcctctcaaacccggagttcctcgcg
gagggcactgcgatcgaagatctgttcaagcctgacagagtgctcattggtggccgggag
acccctgagggcaagaaggctgttcaggctctcaaggaggtgtacgcccactgggttcct
gaggacaggattatcaccaccaacctgtggtccgctgagctctccaagctcgcagccaac
gcgttcttggcacagaggatctcctctgtgaatgccatctccgccctatgcgaggcgact
ggtgccaatgtggccgaggttgcttactctgtgggaaaggactccaggattggccccaag
ttcctgaacgccagtgttggctttggtggatcctgtttccagaaggacatcctgaacctt
gtgtacatctgcgagtgcaatggccttcccgaggtggccaactactggaagcaggtcatc
aagatcaacgactaccagaagagccggtttgtcaaccgcgttgtgtcctccatgttcaac
acagtctccggcaagaagatcgccgtccttggctttgcgttcaagaaggacaccggtgac
accagggagacaccagccattgatgtgtgccacggtctgttgggtgacaaggcacagatc
agcatctacgatccacaggtcaccgaggaccagatccagcgggacctcgccatgagcaag
ttcgactgggaccacccgatgcacctgcagccgaccagccccactgcattcaagcaggtg
agcgtggtgtgggatgcatatgaggccaccaagggggcccatggtgtctgcatcctcacc
gagtgggacgagttcaagaccttggactaccagaagatctttgacaacatgcagaagcct
gcattcgtctttgatgggcgcaatgtggtcgatgccgagaagctcagggagattgggttc
atcgtctactccatcggcaagccgcttgatgcctggctcaaggacatgcccgcggttgca
taa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352147
Entry
4352147           CDS       T01015                                 
Name
(RefSeq) UDP-glucose 6-dehydrogenase 5
  KO
K00012  UDPglucose 6-dehydrogenase [EC:1.1.1.22]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00040  Pentose and glucuronate interconversions
osa00053  Ascorbate and aldarate metabolism
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01240  Biosynthesis of cofactors
osa01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    4352147
   00053 Ascorbate and aldarate metabolism
    4352147
   00520 Amino sugar and nucleotide sugar metabolism
    4352147
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.22  UDP-glucose 6-dehydrogenase
     4352147
SSDB
Motif
Pfam: UDPG_MGDP_dh_N UDPG_MGDP_dh_C UDPG_MGDP_dh NAD_binding_2 Sacchrp_dh_NADP TEX12
Other DBs
NCBI-GeneID: 4352147
NCBI-ProteinID: XP_015620482
UniProt: Q2QS13
LinkDB
Position
12:14893164..14896321
AA seq 480 aa
MVKICCIGAGYVGGPTMAVIALKCPAIEVVVVDISKPRVDAWNSDQLPIYEPGLDEVVKE
CRGRNLFFSTDVEKHVAEADIIFVSVNTPTKTRGLGAGKAADLTYWESAARMIADVSKSD
KIVVEKSTVPVKTAEAIEKILTHNSKGINYQILSNPEFLAEGTAIEDLFKPDRVLIGGRE
TPEGKKAVQALKEVYAHWVPEDRIITTNLWSAELSKLAANAFLAQRISSVNAISALCEAT
GANVSEVAYAVGKDTRIGPKFLNASVGFGGSCFQKDILNLVYICECNGLPEVANYWKQVI
KINDYQKSRFVNRVVASMFNTVSGKKIAVLGFAFKKDTGDTRETPAIDVCHGLLGDKAQI
SIYDPQVTEDQIQRDLSMAKFDWDHPRHLQPTSPTAFKQVSVVWDAYEATKGAHGLCILT
EWDEFKTLDYQRIFDNMQKPAFVFDGRNVVDPEKLREIGFIVYSIGKPLDAWLKDMPAVA
NT seq 1443 nt   +upstreamnt  +downstreamnt
atggtgaagatctgctgcatcggagctggatatgtcggcggcccaaccatggctgtcatt
gccctcaaatgcccagcaattgaggtggtggttgttgacatctccaagcctcgcgttgat
gcctggaacagcgaccagctcccaatctacgagcccggtcttgatgaggttgtgaaggaa
tgcaggggcaggaacctcttcttcagtacggacgtcgagaagcatgtcgctgaggcagac
atcatttttgtgtctgtcaacacccctaccaagacccgtggacttggagcaggcaaggct
gctgacctcacctactgggagagtgctgctcggatgattgctgatgtctccaagtctgac
aagatcgttgttgagaagtccactgtccctgtcaagaccgcagaggccattgagaagatc
ttgacccacaacagcaagggcatcaactaccagatcctctccaacccagaattccttgca
gagggcactgcgattgaagatctcttcaagccagacagagtgctcattggtggccgggag
actcctgaaggaaagaaggctgttcaggctctcaaggaagtttatgcccattgggttcct
gaggacaggattatcaccaccaacctgtggtctgctgagctctccaagctcgcagccaat
gcgttcttggcgcagagaatctcctctgtgaatgccatctctgcactatgtgaggcgact
ggtgccaatgtgtccgaggtggcctatgctgtggggaaagacaccagaatcggccccaag
ttcttgaatgccagtgtcggctttggtggctcctgtttccagaaggacatcctgaacctc
gtgtacatctgcgagtgcaatggccttcctgaggttgccaactactggaagcaggtcatc
aagattaatgactaccagaagagccggtttgtcaaccgtgttgtggcctccatgttcaac
actgtctctggcaagaagattgccgtccttggctttgcgttcaagaaggacaccggtgac
accagggagacacctgccattgatgtgtgccatggcctgttgggtgacaaggctcaaatc
agcatctacgacccacaggtaactgaagatcagatccagcgggacctttccatggccaag
tttgattgggaccacccaaggcacctgcagccaactagccccacggcttttaagcaggtg
agtgtggtctgggatgcgtatgaggccaccaagggagcccatggactgtgcatcctcact
gagtgggacgagttcaagaccttggactaccagaggatctttgacaacatgcagaaacct
gcatttgtcttcgatgggcgcaatgtggtcgatcctgagaagctcagggagattggcttc
attgtctactctatcggcaagccgcttgatgcatggctcaaagacatgcccgcggttgca
taa

DBGET integrated database retrieval system