KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333308
Entry
4333308           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S3-2
  KO
K02985  small subunit ribosomal protein S3e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4333308
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4333308
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4333308
SSDB
Motif
Pfam: Ribosomal_S3_C KH_2 UN_NPL4 Coilin_N
Other DBs
NCBI-GeneID: 4333308
NCBI-ProteinID: XP_015632349
UniProt: A3AJT6 Q75G91
LinkDB
Position
3:complement(21097553..21100030)
AA seq 228 aa
MATQISKKKKFVSDGVFYAELNEMLTRELAEDGYSGVEVRVTPMRTEIIIRATRTQNVLG
EKGRRIRELTSVVQKRFNFPENGVELYAEKVVNRGLCAIAQAESLRYKLLGGLAVRRACY
GVLRFVMESGAKGCEVIVSGKLRAQRAKSMKFKDGYMISSGQPVNEYIDSAVRHVLLRQG
VLGIKVKIMLDWDPKGKVGPTTPLPDLVTIHAPKEEEELRPPVLIAEA
NT seq 687 nt   +upstreamnt  +downstreamnt
atggcgacccagatcagcaagaagaagaagttcgtgagcgatggcgtgttctacgcggag
ctgaacgagatgctgacgcgggagctggccgaggacggctactccggcgtggaggtgcgc
gtgacgccgatgcgcacggagatcatcatccgggccacgaggacgcagaacgtgctcggc
gagaaggggcgcaggatcagggagctcacctccgtcgtgcagaagcgcttcaacttcccc
gagaacggcgtcgagctctacgccgagaaggtcgtcaaccgcggcctctgcgccatcgcc
caggccgagtccctccgctacaagcttcttggaggcctcgccgtccgcagggcttgctat
ggtgttcttcgctttgttatggagagtggtgccaagggttgcgaggtcattgtaagtgga
aagctcagggcccaaagagccaagtccatgaagttcaaggatggttacatgatctcatct
ggtcagccagtcaatgagtacattgactcggctgtgagacacgtgctcctgagacagggt
gttcttggcatcaaggtgaagatcatgctcgactgggaccccaagggcaaggttggcccg
accacccctctgccggatcttgtaaccatccatgctcccaaggaggaggaggagctgcgc
cctccggtgttgatcgctgaggcttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343869
Entry
4343869           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S3-1
  KO
K02985  small subunit ribosomal protein S3e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4343869
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4343869
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4343869
SSDB
Motif
Pfam: Ribosomal_S3_C KH_2 UN_NPL4
Other DBs
NCBI-GeneID: 4343869
NCBI-ProteinID: XP_015647116
UniProt: Q6YTY2 A3BM20
LinkDB
Position
7:complement(25019532..25021751)
AA seq 233 aa
MATHTQISKKRKFVADGVFFAELNEMLTRELAEDGYSGVEVRVTPMRTEIIIRATRTQNV
LGEKGRRIRELTSVVQKRFNFPENGVELYAEKVNNRGLCAIAQAESLRYKLLGGLAVRRA
CYGVLRFVMESGAKGCEVIVSGKLRAQRAKSMKFKDGYMISSGYPVNLYIDSAVRHVLLR
QGVLGIKVKIMLDWDPKGKQGPMTPLPDLVTIHAPKDEDEFSKPLTAEIPVAA
NT seq 702 nt   +upstreamnt  +downstreamnt
atggcgactcacacgcagatcagcaagaagcgcaagttcgtggcggatggggtgttcttc
gcggagctgaacgagatgctgacgcgcgagctcgcggaggacggctactccggcgtcgag
gtccgcgtcacccccatgcgcaccgagatcatcatccgcgccacccgcacccagaacgtc
ctcggcgagaaggggaggaggatccgcgagctgacgtccgtggtgcagaagcggttcaac
ttcccggagaatggcgtcgagctctacgccgagaaggtgaacaaccgcggcctctgcgcc
atcgcccaggccgagtcgctccgctacaagctcctcggtggcctcgccgtcagaagggcg
tgctatggtgtgctcaggtttgttatggagagtggtgctaagggctgtgaggttattgtg
agtgggaagcttagggctcagcgtgctaaatccatgaagttcaaggacggatacatgatt
tcttctggttatcctgttaacttgtatattgactctgctgttagacatgttcttctgaga
cagggtgtgctgggtattaaggtcaagattatgcttgattgggatccgaagggcaagcaa
ggaccaatgactcctttaccggatcttgttaccatccatgcccctaaggatgaggatgag
ttttcaaagcctcttacagctgagatcccagttgctgcttaa

DBGET integrated database retrieval system