KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333347
Entry
4333347           CDS       T01015                                 
Name
(RefSeq) inositol monophosphatase 3
  KO
K10047  inositol-phosphate phosphatase / L-galactose 1-phosphate phosphatase [EC:3.1.3.25 3.1.3.93]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00053  Ascorbate and aldarate metabolism
osa00562  Inositol phosphate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
osa04070  Phosphatidylinositol signaling system
Module
osa_M00114  Ascorbate biosynthesis, plants, fructose-6P => ascorbate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    4333347
   00562 Inositol phosphate metabolism
    4333347
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    4333347
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.25  inositol-phosphate phosphatase
     4333347
    3.1.3.93  L-galactose 1-phosphate phosphatase
     4333347
SSDB
Motif
Pfam: Inositol_P
Other DBs
NCBI-GeneID: 4333347
NCBI-ProteinID: XP_015631786
UniProt: Q6F2U7 A3AJZ8
LinkDB
Position
3:21681933..21685072
AA seq 267 aa
MAEEQFLAVAVDAAKNAGEIIRKGFYQTKNVEHKGQVDLVTETDKACEDLIFNHLRKHYP
DHKFIGEETSAALGATADLTDDPTWIVDPLDGTTNFVHGFPFVCVSIGLTVGKIPTVGVV
YNPIMNELFTAVRGKGAFLNGSPIKTSSQNELVKALLVTEVGTKRDKATLDDTTNRINKL
LFKIRSIRMCGSLALNMCGVACGRLDLCYEIGFGGPWDVAAGALILREAGGFVFDPSGGE
FDLMARRMAGSNSYLKDQFIKELGDTS
NT seq 804 nt   +upstreamnt  +downstreamnt
atggcggaggagcagttcctcgccgtcgcggtggacgccgccaagaacgccggcgagatc
atccgcaagggcttctaccagaccaagaacgtggagcacaagggccaggtggatttggtg
acggagacggacaaggcctgcgaggacctcatcttcaaccacctccggaagcactacccg
gaccacaagttcatcggcgaggagacgtccgcggcgctcggcgccaccgcggacctcacc
gacgacccgacctggatcgtcgaccccctcgatggcaccaccaatttcgtccatggcttc
ccttttgtttgcgtctcgatcggtctcaccgtcgggaaaattcctactgttggagttgtg
tacaaccccatcatgaatgagcttttcacagctgttcgtggaaaaggtgccttcctcaat
ggttctccaatcaaaacttcatctcaaaacgagctggtgaaggctcttctggtaacagag
gttggaaccaaaagagataaggccactctggatgatacaacaaacagaatcaacaagtta
ctattcaagattagatctatacggatgtgtggctcgttggccttgaacatgtgtggagtt
gcctgtggtaggcttgatttgtgttatgagattggatttggtggcccctgggatgtggcc
gctggagctctgattcttcgggaagctggtggttttgtttttgatccgagtggtggggag
tttgatctgatggcacgaagaatggcaggatcaaacagctatctgaaggatcaattcatc
aaagaattgggagatacaagttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342620
Entry
4342620           CDS       T01015                                 
Name
(RefSeq) bifunctional phosphatase IMPL2, chloroplastic
  KO
K18649  inositol-phosphate phosphatase / L-galactose 1-phosphate phosphatase / histidinol-phosphatase [EC:3.1.3.25 3.1.3.93 3.1.3.15]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00053  Ascorbate and aldarate metabolism
osa00340  Histidine metabolism
osa00562  Inositol phosphate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
osa04070  Phosphatidylinositol signaling system
Module
osa_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    4342620
   00562 Inositol phosphate metabolism
    4342620
  09105 Amino acid metabolism
   00340 Histidine metabolism
    4342620
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    4342620
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.15  histidinol-phosphatase
     4342620
    3.1.3.25  inositol-phosphate phosphatase
     4342620
    3.1.3.93  L-galactose 1-phosphate phosphatase
     4342620
SSDB
Motif
Pfam: Inositol_P
Other DBs
NCBI-GeneID: 4342620
NCBI-ProteinID: XP_015646976
UniProt: Q0D817 Q6Z4I1
LinkDB
Position
7:4890231..4893669
AA seq 340 aa
MLPATSTVPPTSPLPHSRAAPRRHLRAGLLHGSVATAAVVRACGVTTGHRRRMGSVRASP
RAGGWEVAMADKEGVGVERLVEVAQRAADAAGEVLRKYFRQRVEIIDKEDQSPVTIADRE
AEEAMVSVILKSFPSHAVFGEENGWRCVEKSADYVWVLDPIDGTKSFITGKPLFGTLISL
LYKGKPVIGIIDQPILRERWVGVDGMKTTLNGQEISVRPCNVLAQAYLYTTSPHLFAGEA
EDAFIRVRDKVKVPLYGCDCYAYALLASGFVDLVVESGLKPYDFLSLVPVIEGAGGSITD
WKGNKLHWPVSAESRPESFNVVASGDARVHKQALDALQWH
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgctcccggccacctccaccgtcccacccacctcgccccttccccactcccgcgctgcc
ccgcgccgccacctccgcgcagggcttctccacgggtccgtggcgacggcggcggtggtt
cgggcgtgcggggtgacgacgggccaccgtcggaggatgggctcggttcgggcgagcccc
agggcaggcggatgggaggtggcgatggcggataaggagggggtaggggtggagcggcta
gtggaggtggcgcagagggcggcagacgccgcaggggaggtgctcaggaagtacttccgg
caacgcgtcgagatcatcgacaaggaggatcagagtcctgtaactattgcagatagagaa
gcggaagaagcaatggtgtcagtcattctgaagagcttcccttcccatgccgtttttggt
gaggaaaatggttggagatgcgtggaaaagtctgctgattatgtttgggttttggacccc
atagatggaacaaaaagcttcataactggcaagcctctgtttggtacgcttatttcactc
ttgtacaaggggaagccggttattggcatcattgatcagccaatcttgagagaaagatgg
gttggggttgatgggatgaaaacaaccttaaatggacaagaaatatctgttcgcccttgc
aatgtcctggcacaagcttacttatatacaacaagtccacatttgtttgcaggagaagct
gaagatgcatttattcgtgtacgggataaggtcaaagtcccactgtatggttgcgattgc
tatgcctatgctcttcttgcctctggttttgtagatcttgttgttgaatcaggattgaag
ccatatgattttctctcattggtaccagtcattgaaggagctggaggttcaataacagat
tggaaaggaaacaagctccattggcctgtctctgcggaatcacggcctgaaagtttcaat
gtggtggcatctggagacgcccgtgtccacaagcaggcccttgatgcgttgcaatggcac
tag

DBGET integrated database retrieval system