KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333393
Entry
4333393           CDS       T01015                                 
Name
(RefSeq) UDP-arabinopyranose mutase 1
  KO
K13379  reversibly glycosylated polypeptide / UDP-arabinopyranose mutase [EC:2.4.1.- 5.4.99.30]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4333393
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4333393
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-
     4333393
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.30  UDP-arabinopyranose mutase
     4333393
Glycosyltransferases [BR:osa01003]
 Polysaccharide
  Structural polysaccharide
   4333393
SSDB
Motif
Pfam: RGP Glyco_tranf_2_2
Other DBs
NCBI-GeneID: 4333393
NCBI-ProteinID: XP_015631326
UniProt: Q8H8T0 A0A345YV63
LinkDB
Position
3:complement(22381375..22383939)
AA seq 364 aa
MAGTVTVPSASVPSTPLLKDELDIVIPTIRNLDFLEMWRPFFQPYHLIIVQDGDPTKTIR
VPEGFDYELYNRNDINRILGPKASCISFKDSACRCFGYMVSKKKYVFTIDDDCFVAKDPS
GKDINALEQHIKNLLSPSTPFFFNTLYDPYREGADFVRGYPFSLREGAKTAVSHGLWLNI
PDYDAPTQMVKPRERNSRYVDAVMTVPKGTLFPMCGMNLAFDRDLIGPAMYFGLMGDGQP
IGRYDDMWAGWCMKVICDHLSLGVKTGLPYIWHSKASNPFVNLKKEYKGIFWQEDIIPFF
QNATIPKECDTVQKCYLSLAEQVREKLGKIDPYFVKLADAMVTWIEAWDELNPSTAAVEN
GKAK
NT seq 1095 nt   +upstreamnt  +downstreamnt
atggcggggacggtgacggtgccgtcggcgtcggtgccgtcgacgccgctgctcaaggac
gagctggacatcgtgatcccgacgatccgcaacctggacttcctggagatgtggcggccc
ttcttccagccctaccacctcatcatcgtgcaggacggcgacccgaccaagaccatccgc
gtccccgagggcttcgactacgagctctacaaccgcaacgacatcaaccggatcctcggc
cccaaggcctcctgcatctccttcaaggactccgcatgccgctgcttcggctacatggtc
tccaagaagaagtacgtcttcaccatcgacgacgactgcttcgttgccaaggacccatct
ggcaaggacatcaatgctcttgagcagcacatcaagaacctcctcagcccgtccaccccg
ttcttcttcaacaccttgtatgatccctaccgcgaaggcgctgactttgtccgtggttac
cccttcagcctcagggagggagccaagactgctgtctctcacggcctgtggcttaacatc
cctgactatgatgctcctactcagatggtcaagcctcgtgagaggaactccaggtatgtt
gatgctgtcatgactgtgcccaagggaaccttgttccccatgtgtggcatgaaccttgct
tttgaccgtgatctcatcggtcctgcaatgtactttggtctcatgggtgatggccagcct
attggtcgctacgacgacatgtgggctggatggtgcatgaaggtcatctgtgaccacctg
agcctgggagtgaagactggactgccgtacatctggcacagcaaggctagcaaccccttc
gtgaacttgaagaaggaatacaagggcatcttctggcaggaggacatcatccccttcttc
cagaacgccaccatccccaaggagtgcgacaccgtccagaagtgctacctctccctcgcc
gagcaggtcagggagaagctcggcaagatcgacccctacttcgtcaagcttgccgatgcc
atggtcacctggatcgaggcctgggatgagctgaacccctcgactgctgctgtcgagaac
ggcaaggccaagtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337282
Entry
4337282           CDS       T01015                                 
Name
(RefSeq) probable UDP-arabinopyranose mutase 2
  KO
K13379  reversibly glycosylated polypeptide / UDP-arabinopyranose mutase [EC:2.4.1.- 5.4.99.30]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4337282
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4337282
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-
     4337282
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.30  UDP-arabinopyranose mutase
     4337282
Glycosyltransferases [BR:osa01003]
 Polysaccharide
  Structural polysaccharide
   4337282
SSDB
Motif
Pfam: RGP DUF6103
Other DBs
NCBI-GeneID: 4337282
NCBI-ProteinID: XP_015635492
UniProt: Q7FAY6
LinkDB
Position
4
AA seq 347 aa
MSLEIQDSEVDIVIAALQPNLTTFFEAWRPFFSRFHIIVVKDPDMAEELQIPTGFDLKVY
TKSDMGVLGATSIDFSGHSCRYFGYLVSRKKYVISIDDNCLPAKDNGGLTVDAVAQHMSN
LKTPATPFFFNTLYDPFRKGADFVRGYPFSLREGVECMLSCGLWLHNADYDPMTHVVKRN
QRNTTYVDAVMTVPLGAMMPVSGINVAFNREVLGPVMFPALRLRKEGKHRWDTLEDVWNG
LCAKVVCDRLRYGVKTGLPYVMRSDAEAGKALESLKEWEGVKVMDVVLPFFESLKLSSTS
VTVEDCVKELTSIVKEKLGPQNAIFAKAADAMEEWTKLWKSHGAQSA
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgtctttggaaattcaggacagtgaggtcgacattgtgattgcagcactccagcccaac
ctgactactttctttgaggcatggaggccatttttctctcggttccacatcattgttgtc
aaagatccagatatggctgaggagcttcaaatccctacaggttttgatctcaaggtttat
acgaagtcagatatgggagtgcttggagccacatccatcgacttctctggtcactcatgc
cgttactttgggtaccttgtctcacgcaagaagtatgtcatctcaattgatgacaattgc
ctcccagcgaaggacaatggtgggttgactgttgatgcagttgcacagcatatgtccaat
ctgaagacacctgctacacctttctttttcaacacattgtatgatccattccgcaaaggg
gctgactttgtccgtggatacccatttagtctgcgcgagggggttgagtgcatgctctct
tgtgggctgtggcttcacaatgcagactatgacccaatgactcatgttgtgaagagaaat
caacgcaacacaacgtatgtggatgctgtgatgacagttccacttggtgcgatgatgcct
gtgagcgggataaatgttgcattcaaccgtgaggtgctgggacctgtaatgttccctgct
ctgcggctgcgcaaggaaggaaagcacagatgggatacacttgaagacgtttggaatggc
ttgtgtgctaaagtggtgtgtgatcgcttacggtatggcgtgaagacaggtcttccttat
gtgatgagaagtgatgcagaagcaggtaaggctctcgagagcttgaaagaatgggaaggg
gtgaaagtcatggacgtcgttcttcccttcttcgaatctctgaagctatcgagtacttca
gttactgttgaagactgtgttaaggaactaaccagcattgtcaaggagaaactgggaccg
cagaatgcaatcttcgctaaagctgctgatgcaatggaggaatggaccaaactctggaaa
tctcacggagctcaaagcgcttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343849
Entry
4343849           CDS       T01015                                 
Name
(RefSeq) UDP-arabinopyranose mutase 3
  KO
K13379  reversibly glycosylated polypeptide / UDP-arabinopyranose mutase [EC:2.4.1.- 5.4.99.30]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4343849
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4343849
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-
     4343849
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.30  UDP-arabinopyranose mutase
     4343849
Glycosyltransferases [BR:osa01003]
 Polysaccharide
  Structural polysaccharide
   4343849
SSDB
Motif
Pfam: RGP Glyco_tranf_2_2
Other DBs
NCBI-GeneID: 4343849
NCBI-ProteinID: XP_015647980
UniProt: Q6Z4G3
LinkDB
Position
7:24773282..24776524
AA seq 366 aa
MASSDAAAAQAATPLLKDELDIVIPTIRNLDFLEMWRPFFQPYHLIIVQDGDPKKTIRVP
EGFDYELYNRDDINRILGPRASCISFKDSACRCFGYMVSKKKYIYTIDDDCFVAKDPSGK
DINALEQHIKNLLNPSTPFFFNTLYDPYRDGADFVRGYPFSLREGAPTAVSHGLWLNIPD
YDAPTQLVKPLERNSRYVDAVMTIPKGTLFPMCGMNLAFDRDLIGPAMYFGLMGDGQPIG
RYDDMWAGWCTKVITDHLGLGVKTGLPYIWHSKASNPFVNLKKEYNGIFWQEELIPFFQS
ASLPKEADTVQKCYLELAKQVRAKLGKVDGYFNKLADSMVTWIEAWDQLNPPKGAVATAN
GTAKSK
NT seq 1101 nt   +upstreamnt  +downstreamnt
atggcttcctccgacgccgcggccgcgcaggcggcgacgccgctgctgaaggacgagctg
gacatcgtgatcccgacgatccgcaacctggacttcctggagatgtggaggcccttcttc
cagccgtaccacctcatcatcgtccaggacggcgaccccaagaagacgatccgggtgccc
gagggcttcgactacgagctctacaaccgcgacgacatcaaccggatcctcggccccagg
gcctcctgcatctccttcaaggactccgcctgccgctgcttcggctacatggtctccaag
aagaagtacatctacaccatcgacgacgactgcttcgttgctaaagacccatcaggaaag
gatatcaatgcacttgagcagcacatcaagaaccttctgaacccttccactccatttttc
ttcaacactttgtatgacccgtaccgtgatggcgctgattttgtccgtgggtaccccttc
agcctccgtgagggtgccccgactgccgtttctcatgggctttggctcaacattccagac
tatgatgcccctacccagcttgtcaagcctcttgagaggaacagcaggtatgtggatgct
gttatgacaatcccgaagggcactttattcccgatgtgtggaatgaaccttgcttttgac
cgtgacctcatcggtcctgcgatgtactttggtcttatgggtgatggccagcctattggt
cgttacgacgatatgtgggcaggatggtgcaccaaggtgattaccgatcacttgggtttg
ggtgttaagactggccttccctacatctggcacagcaaagcgagcaacccctttgtgaac
ctcaagaaggaatacaacggcatattctggcaggaggagctgatccccttcttccagtct
gcgtccctcccgaaggaggccgacactgtccagaagtgttaccttgagctggccaagcaa
gtgagggcgaagctcgggaaggtcgatggctacttcaacaagctcgccgactccatggtc
acatggattgaggcctgggatcagctgaacccaccaaagggagctgttgccaccgcaaac
ggcactgccaagagcaagtga

DBGET integrated database retrieval system