KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333399
Entry
4333399           CDS       T01015                                 
Name
(RefSeq) cytochrome P450 85A1
  KO
K09590  brassinosteroid-6-oxidase 1 [EC:1.14.-.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00905  Brassinosteroid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00905 Brassinosteroid biosynthesis
    4333399
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:osa00199]
    4333399
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     4333399
Cytochrome P450 [BR:osa00199]
 Cytochrome P450, plant type
  CYP85 family
   4333399
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 4333399
NCBI-ProteinID: XP_015631644
UniProt: Q8GSQ1
LinkDB
Position
3:22538341..22542438
AA seq 469 aa
MVLVAIGVVVAAAVVVSSLLLRWNEVRYSRKRGLPPGTMGWPLFGETTEFLKQGPSFMKA
RRLRYGSVFRTHILGCPTVVCMEAELNRRALASEGRGFVPGYPQSMLDILGRNNIAAVQG
PLHRAMRGAMLSLVRPAMIRSSLLPKIDAFMRSHLAAWSSSSSSAVVDIQAKTKEMALLS
ALRQIAGVSAGPLSDALKAELYTLVLGTISLPINLPGTNYYQGFKARKKLVAMLEQMIAE
RRSSGQVHDDMLDALLTGVEGTREKLTDEQIIDLIITLIYSGYETMSTTSMMAVKYLSDH
PKALEQLRKEHFDIRKGKAPEDAIDWNDFKSMTFTRAVIFETLRLATVVNGLLRKTTQDV
EMNGYVIPKGWRIYVYTREINYDPFLYPDPMTFNPWRWLEKNMESHPHFMLFGGGSRMCP
GKEVGTVEIATFLHYFVTQYRWEEEGNNTILKFPRVEAPNGLHIRVQDY
NT seq 1410 nt   +upstreamnt  +downstreamnt
atggtgttggtggcgattggggtggttgtggcggcggcggtggtggtgagcagcctgctg
ctgcggtggaacgaggtgcggtacagccggaagcgcggcctgccgccggggacaatgggg
tggccgctcttcggcgagaccaccgagttcctcaagcagggacccagtttcatgaaggcc
cggaggctcaggtacgggagcgtgttcaggacgcacatcctggggtgcccgacggtggtg
tgtatggaggcggagctgaaccggcgggcgctggccagcgaagggcgcgggttcgtcccg
ggctacccgcagtcgatgctggacatcctggggcggaacaacatcgccgccgtgcagggc
cccctccaccgcgccatgcgcggcgccatgctctccctcgtccgccccgccatgatccgc
tcctccctcctccccaagatcgacgccttcatgcgctcccacctcgccgcctggtcctcc
tcctcctcctccgccgtcgtcgacatccaggccaagaccaaggagatggccttgctatct
gcactcaggcagattgccggcgtctccgctggcccactctctgacgctctcaaggcagag
ctctacacccttgtgcttggcaccatctccctgcccatcaaccttcctggaaccaactac
taccaaggcttcaaggcaaggaagaagcttgttgcaatgctagagcagatgatcgcggaa
cggcgatcctccggtcaggtacacgacgacatgctggatgcgctcttgaccggtgtcgag
ggcaccagggagaagctcacagatgagcagatcattgacctgatcatcacccttatatac
tctggatatgaaaccatgtcgacgacctcgatgatggctgtcaagtacctgtcagaccat
cccaaagctcttgagcaactcaggaaagaacattttgatatcaggaaaggtaaagcgccc
gaagatgccatcgactggaatgatttcaagtccatgaccttcactcgagctgttatcttc
gagacattaagattagctacagttgtgaatgggctgctgaggaaaactacccaagatgtt
gaaatgaatgggtatgttatcccaaaaggttggagaatatatgtttacacaagggaaata
aattatgatccattcctgtaccctgatcccatgacattcaatccatggaggtggctggag
aagaacatggaatcacatccacacttcatgctgtttggaggaggtagtcgaatgtgcccg
gggaaggaagtaggcaccgtagaaattgcaacattccttcactatttcgtgactcaatac
agatgggaggaagaaggtaacaacacaatattgaagttcccccgagttgaagctcccaac
gggttacatatccgcgttcaagattactga

DBGET integrated database retrieval system