KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333538
Entry
4333538           CDS       T01015                                 
Name
(RefSeq) vacuolar protein sorting-associated protein 2 homolog 2
  KO
K12191  charged multivesicular body protein 2A
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4333538
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4333538
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4333538
Membrane trafficking [BR:osa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    4333538
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4333538
  Exosomal proteins of other body fluids (saliva and urine)
   4333538
  Exosomal proteins of colorectal cancer cells
   4333538
SSDB
Motif
Pfam: Snf7 YlqD MerR-DNA-bind Cep57_MT_bd Flagellin_C COG2
Other DBs
NCBI-GeneID: 4333538
NCBI-ProteinID: XP_015627777
UniProt: Q6ASS4 B9F9W6
LinkDB
Position
3:complement(24596682..24600370)
AA seq 229 aa
MNIFKKKVDPKEALRTSKREMSVATRGVEREIGSLQMEEKKLVAEIKKTAKTGNEAATKI
LARQLVRLRQQIVNLQGTRAQIRGVATHTQAMYAGTSISAGMKGASKAMAAMNKQMEPTK
QIKVMREFQKQSNQLDMTLEMMSDAIDETLDKDEAEEETEELTNQVLDEIGVDVASQLSS
APKGRIAASNRKAESNQARNAAPPRNNVEPESSAEVDDLERRLASLRRI
NT seq 690 nt   +upstreamnt  +downstreamnt
atgaacatcttcaagaagaaggtcgaccccaaagaggctctcaggaccagcaagagggag
atgtcagttgctacacggggagttgagagagagattggctccctgcaaatggaggagaag
aaactagttgctgagattaagaaaactgctaagacaggaaatgaggctgcgaccaaaatc
ctagctcggcaacttgtgaggcttaggcaacaaattgtcaatttgcaaggcacgcgggca
caaatacgtggagttgctactcatacacaggcaatgtacgcaggcacttcaatatctgca
ggaatgaaaggtgcaagcaaagcaatggcagcaatgaataagcaaatggaaccaacaaaa
cagatcaaggttatgagagaattccagaaacaatcaaatcagttggacatgacgcttgaa
atgatgtccgatgctatagatgaaacacttgataaggacgaggcagaagaggaaacagaa
gaacttactaaccaggttcttgatgagattggtgttgatgtggcttctcagctgtcttca
gctcctaaaggtcgtattgcggcgagcaacaggaaagctgagagcaaccaagcacgaaat
gccgctccccccagaaataacgtggagcctgaatcctctgctgaagttgacgacctggag
aggagactggcttcacttcgccgcatctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342791
Entry
4342791           CDS       T01015                                 
Name
(RefSeq) vacuolar protein sorting-associated protein 2 homolog 1
  KO
K12191  charged multivesicular body protein 2A
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4342791
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4342791
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4342791
Membrane trafficking [BR:osa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    4342791
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4342791
  Exosomal proteins of other body fluids (saliva and urine)
   4342791
  Exosomal proteins of colorectal cancer cells
   4342791
SSDB
Motif
Pfam: Snf7 HTH_6 Expansin_C PspA_IM30 Cas9_Topo YlqD
Other DBs
NCBI-GeneID: 4342791
NCBI-ProteinID: XP_015647002
UniProt: Q8H430 Q0D7L1
LinkDB
Position
7:7621477..7626701
AA seq 225 aa
MSFLFGKRKTPAELLRENKRMLDRSIREIERERQGLQAQEKKLITEIKKTAKEGQMGAVK
VMAKDLIRTRHQITKFYQLKSQLQGVSLRVQTLKSTQAMGDAMKGVTKAMGQMNRQLNLP
GLQRIMMEFERQNERMEMTSEVMGDAIDDALEGDEDQEEETEELVNQVLDEIGIDINQEL
VKAPSAAVAQPAAAGKVAQAESAGGNGDGGIDADLQARLDNLRRM
NT seq 678 nt   +upstreamnt  +downstreamnt
atgagtttcttgttcgggaagcggaagacgcctgctgagctcttgagagagaacaagaga
atgctggatcgatcaataagggaaattgaacgagaaagacagggattgcaagcccaggag
aaaaaactcattactgagattaagaaaacagcaaaggaaggccagatgggtgctgtcaaa
gtaatggccaaagatcttattcgaacacggcatcagatcacaaagttttaccaacttaaa
tctcagcttcaaggagtttctctaagagttcagacgctgaaatctacacaagctatgggt
gatgccatgaaaggtgttacaaaggctatgggtcagatgaacaggcagttaaatctgcca
ggattacagaggattatgatggagtttgagcgacaaaatgagagaatggagatgacgagt
gaagtcatgggggatgctatagatgatgctttggagggagatgaggatcaagaggaagaa
actgaggagcttgtgaatcaagtccttgatgaaattggcattgatattaaccaagagctt
gtaaaggccccttcggctgccgtcgctcagcccgcagcagcaggaaaggttgcgcaggct
gaatctgctggtgggaatggtgacggtggaatcgacgcggatttgcaggcgaggctggac
aatctgaggagaatgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348891
Entry
4348891           CDS       T01015                                 
Name
(RefSeq) vacuolar protein sorting-associated protein 2 homolog 3
  KO
K12192  charged multivesicular body protein 2B
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4348891
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4348891
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4348891
Membrane trafficking [BR:osa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    4348891
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4348891
SSDB
Motif
Pfam: Snf7 YlqD CCAP Cep57_MT_bd Flagellin_C DUF1694 DnaJ-X DUF2570
Other DBs
NCBI-GeneID: 4348891
NCBI-ProteinID: XP_015614222
UniProt: Q9AUZ6 A3C5Q1
LinkDB
Position
10:complement(17746580..17750061)
AA seq 212 aa
MNPFAKKPTPREAIRSSKRELTNATRGIERDIGTLQLEEKRLVAEIKRTAKTGNEAATRI
LARQLIRLRQQISNLQGSRAQIRGIATHTQAMHANTSVAAGMQSASKAMGALNKQMDPAK
QMKVMQEFQKQSAQMDMTNEMMSDSIDNILDDDQAEEETEDLANQVLDEIGVDIASQLSS
APKGRITGKKVQADESSELDELEKRLAALKNP
NT seq 639 nt   +upstreamnt  +downstreamnt
atgaaccccttcgcgaagaagcccacgccgcgagaggcgatccggagcagcaaacgtgag
ctgacgaatgctaccagaggtattgagagagatattggaacgttgcagctagaggaaaag
aggctagttgctgaaatcaaaaggactgcaaaaactggcaatgaggcagcaaccagaatt
ctggcccgccagctgatcaggctaagacagcaaatttctaatttacaaggtagcagagct
cagattaggggcattgcaacacatacacaggcaatgcatgccaacacttcagtggctgct
ggcatgcaaagtgcaagcaaagcaatgggagctttgaacaagcaaatggatccagccaaa
cagatgaaggtgatgcaagaattccaaaaacagtcagcacaaatggatatgacgaatgag
atgatgtctgactccattgacaatatcttagacgatgatcaagctgaggaagaaactgaa
gaccttgcaaatcaggtcctggatgagattggtgttgatattgcctcacagttatcctca
gctcctaaaggaaggattactggaaagaaggttcaagctgatgaaagttcagaattggac
gaactcgagaagaggctggctgctctgaaaaatccatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351205
Entry
4351205           CDS       T01015                                 
Name
(RefSeq) vacuolar protein sorting-associated protein 2 homolog 1
  KO
K12191  charged multivesicular body protein 2A
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4351205
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4351205
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4351205
Membrane trafficking [BR:osa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    4351205
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4351205
  Exosomal proteins of other body fluids (saliva and urine)
   4351205
  Exosomal proteins of colorectal cancer cells
   4351205
SSDB
Motif
Pfam: Snf7 Expansin_C DUF3482 DUF677
Other DBs
NCBI-GeneID: 4351205
NCBI-ProteinID: XP_015615103
UniProt: Q762A5
LinkDB
Position
11:complement(28786008..28788237)
AA seq 224 aa
MSFIFGKRKTPAELLRENKRMLDKSIREIERERQGLQAQEKKLIAEIKKVAKQGQMGAVK
IMAKDLIRTRHQITKFYALKSQLQGVSLRIQTLKSTQAMGEAMKGVTKAMRQMNRQMNLP
ALQKIMREFEIQNEKMEIVSSTMNDAIDDALEGDEEEEETEELVNQVLDEIGIDVNSELV
GAPSTAVAAPVGAGKVAAQVEAAGGGDGGIDDDLQARLDNLRKM
NT seq 675 nt   +upstreamnt  +downstreamnt
atgagcttcatcttcggcaagcggaagaccccagccgagttgctgcgggagaacaagcgg
atgctggataaatccatcagggagatcgagagggagaggcagggcctgcaggctcaggag
aagaagctcatcgccgagatcaagaaggtggccaagcaaggacagatgggagccgtaaaa
attatggcaaaggaccttatccgcacaagacatcagatcacaaaattctatgccctcaag
tcccagctacagggtgtatctcttcgaattcagacattgaaatcgacacaagctatgggt
gaggccatgaagggtgtcacaaaagccatgagacagatgaacaggcagatgaatctacca
gctctgcagaagataatgcgggagtttgagatacaaaacgagaagatggagatagtcagt
agcacaatgaatgatgccattgacgatgctttggagggcgatgaggaggaggaagaaaca
gaagaactggtaaaccaggtccttgacgaaattggcatcgacgtcaactcagagcttgtc
ggggctccttcaaccgctgttgctgcaccggttggagcaggaaaggttgccgctcaagtt
gaagccgctggaggtggggacggtgggatagatgacgacctacaggcccggcttgataat
ctgaggaagatgtga

DBGET integrated database retrieval system