KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333591
Entry
4333591           CDS       T01015                                 
Name
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit C, chloroplastic/mitochondrial
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00970  Aminoacyl-tRNA biosynthesis
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    4333591
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:osa03029]
    4333591
Enzymes [BR:osa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     4333591
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     4333591
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    4333591
SSDB
Motif
Pfam: Glu-tRNAGln
Other DBs
NCBI-GeneID: 4333591
NCBI-ProteinID: XP_015628845
UniProt: Q7XZZ1
LinkDB
Position
3:25276382..25278546
AA seq 153 aa
MLSAAASAIPRLRWAAPPRNQSARNQWLLLRRRSLSSSPPYVTPGIPAAAAAAGSGALEP
PDLPRLANAARISLSPEEAEEFAPKIRQVVDWFGQLQAVDLESVEPSLRAGTAAGNSLRE
DRPETFTNRDAIIESVPSYDDPYIKVPRVLNKE
NT seq 462 nt   +upstreamnt  +downstreamnt
atgctctccgccgccgcctcggccatcccgaggctccgctgggccgcgccgccgcggaac
cagtctgcgaggaaccaatggttgctgctgcggcggcgttccctctcctcctcacctccc
tacgtgacgcccggtatcccggcggcggcggcggcggcagggagtggggctctcgagccg
ccggacctgccccgcctcgccaacgcggcacgcatctctctctcgccggaagaggctgag
gagttcgcgccgaagattcggcaggtggtggattggtttgggcaacttcaagccgtcgat
cttgaatctgttgagccttcacttagagctggtactgcggcaggtaattcattgagagaa
gacaggcctgaaacatttactaacagagatgccataatagagtctgtcccaagctatgat
gatccatacatcaaggtgccaagagtgctgaacaaagaatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337177
Entry
4337177           CDS       T01015                                 
Name
(RefSeq) LOW QUALITY PROTEIN: glutamyl-tRNA(Gln) amidotransferase subunit A, chloroplastic/mitochondrial-like
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00970  Aminoacyl-tRNA biosynthesis
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    4337177
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:osa03029]
    4337177
Enzymes [BR:osa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     4337177
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     4337177
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    4337177
SSDB
Motif
Pfam: Amidase
Other DBs
NCBI-GeneID: 4337177
NCBI-ProteinID: XP_015634925
LinkDB
Position
4:complement(32736547..32739873)
AA seq 516 aa
MPPPLQAQRLLLSHRRLPSPHLRCFTAVSSLPSAPAKTVAAAAAHAPSSILSIRESLLSG
ERTAAEITAEYLSRLRRTEPSVRSFIHVADAAAEREAEELDRRIATEGLDAVGPLAGVLV
GVKDNLCTANMPSTGGSRILDGYQPAYDATAVRRLREAGAIVVGKTNLDEFGMGSTTEGS
GFQVTTNPWDDSRVPGGSSGGSASAVSARQCVVSLGSDTGGSVRQPASFCGVVGLKPTYG
RVSRFGLMAYASSLDVVGCFGSSVVDTATILSVIAGHDKMDSTSSSHDVSDYKSELVPLD
LLESKPLNGMRIGIIQETLGEGVETGVISSIKDAASHLEQLGSVVEEVSLPSFSLGLPAY
YILASSEASSNLSRYDGIRYGRQVSGDDLNELYGGSRANGLGHEVKMRILMGTYALSAGY
YDAYYKRAQQVRTLVKKSFKEALERYDILVSPAAPSAAYKIGEKINDPLAMYAGDTMTVN
VNLAGLPALVVPCGFLRXICGAPVGLQMIGSPFSEG
NT seq 1551 nt   +upstreamnt  +downstreamnt
atgccgccgcctctccaggcccagcgcctcctcctgtcccaccgacgcctcccttctccc
cacctccgctgcttcaccgccgtctcctccctcccgtccgctcccgccaagacggtggcg
gccgcggcggcccacgccccctcctccatcctctccatccgcgagtcgctcctctccggc
gagaggaccgcggcggagatcaccgcggaatacctctcccgcctccgccgcaccgagccg
agcgtgcgcagcttcatccacgtggcggacgccgccgccgagcgggaggcggaggagctc
gaccggaggattgccaccgaggggctggatgcggtggggcctctggccggggtgctcgtc
ggcgtgaaggacaacctctgcaccgccaatatgccctccacaggtgggtcgcgaatactg
gacggttaccagccggcgtacgatgccactgcggtgcggcggcttcgtgaggcgggcgcc
attgttgtggggaagactaacctagacgagttcggcatggggagcactacagagggctcc
gggtttcaggtcacaacaaacccttgggacgattcacgtgtgcctgggggatcctcaggt
ggttctgcttctgcggtctctgctagacaatgtgtggtatccttagggagtgatacaggt
ggaagtgtgagacagccagcatcattttgtggtgtggtagggttaaagccaacctatggc
cgggtttctcgtttcggcctcatggcttatgcttcatcactagatgttgtgggatgcttt
ggttcatcagttgttgacactgcgacaatcttgtcagtaattgctggccatgacaaaatg
gattcaactagtagctctcatgatgtttcagactataaatcagagttggtcccactagat
ttgctagaatcaaaaccattaaatggtatgagaattggaattattcaagaaactcttggt
gagggtgtagaaactggagtcatatcatcaatcaaggatgctgcttctcacttggaacaa
ttgggatcagtggtggaagaggtttctctgccttcattttctcttggcctacccgcatat
tacatactggcttcatctgaagcctcttctaatctatcacgttatgatggtatcaggtat
gggaggcaggtttcaggcgatgacttgaatgaactttatggaggttcccgggctaacggt
ctgggtcacgaggtcaaaatgagaattttgatgggaacttatgctttatctgctggatac
tatgatgcatactacaaacgagcacaacaggtaaggacactggttaagaaaagcttcaaa
gaagctctggaaagatacgatattcttgtttcacctgctgcgccatcagcagcttacaag
ataggtgaaaagataaatgatccattagctatgtatgcaggagataccatgacggtgaat
gttaatttggctggtctccctgcattggttgtgccttgtggatttttgaggntgatctgc
ggggctcccgttggacttcagatgattggatcccccttcagtgaggggtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350686
Entry
4350686           CDS       T01015                                 
Name
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00970  Aminoacyl-tRNA biosynthesis
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    4350686
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:osa03029]
    4350686
Enzymes [BR:osa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     4350686
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     4350686
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    4350686
SSDB
Motif
Pfam: GatB_N GatB_Yqey
Other DBs
NCBI-GeneID: 4350686
NCBI-ProteinID: XP_015615285
UniProt: Q2R2Z0
LinkDB
Position
11:complement(20029921..20034670)
AA seq 544 aa
MALTLLRGMRTPVVARRNAGLFFTTLQSPLLSRFTMRAESARAAAPKSIQLATKEAAEQK
AQGFEAVIGIETHVQLSTVTKAFCSCPYSYGSQPNSTVCPTCMGHPGTLPVLNAKVVECA
VRLGLALNCEIAMTSKFDRKQYFYPDLPKGYQISQFDIPIAKEGYLDLDLPVEFGGGHRR
FGVTRVHMEEDAGKLLHSESGSYSQVDLNRAGVPLLEIVSEPDMRTGIEAAEYGAELQRL
VRYLGVSNGNMQEGSLRCDVNVSVRPIGQSNFGTKVEIKNMNSFSAISRAIDYEISRQIL
LHKEGQADQIVQETRLWDESSQKTFTMRKKEGLADYRYFPEPDLPEVVLTSEYIDEIQNS
MPELPEAKRRRFENMGLSMQDVLFLANDDNVARFFDSTLEHGADAKLAANWIMGDIAAYL
KNEKLSIDEIKLTPLELSELIASIRNGTISGKIGKEILIELIAKGGTVKSVIEEKDLVQI
ADPAAIEAMVDQVLADNPKQLEQYRSGKTKLQGFFAGQVMKASKGKANPVLLNKILGEKL
KANS
NT seq 1635 nt   +upstreamnt  +downstreamnt
atggcactgacccttctcagagggatgcgaacgccggttgtagctagaaggaatgctggc
ttgttcttcaccacattgcagtctccgttgttgtcccgcttcacgatgagagcggagagc
gcgcgggccgcagcgcccaagtcgattcagctggcgaccaaggaggcggcggagcagaag
gcgcagggcttcgaggcggtcatcgggatcgagacccatgtccagctctcgacggtcaca
aaggcgttctgctcgtgcccgtacagctacgggtcgcagccgaacagcaccgtctgcccc
acctgcatggggcaccccggaacgctgcccgttcttaacgcaaaggttgtcgaatgcgcc
gtgaggttgggcctcgctctcaattgcgagatcgcgatgacgtccaagtttgatcggaag
cagtacttctacccggacctgcccaaggggtatcagatttcgcagtttgacattcccatt
gccaaggagggttaccttgatttggatcttccggtggagttcggcggtgggcataggaga
tttggggtcacaagggtgcatatggaagaagatgctggcaagctgcttcactctgaatcc
gggagttactctcaggttgacttaaatagggctggcgttcctttacttgaaattgtctca
gagccagatatgagaacagggatagaggctgccgagtatggtgctgagctacagaggctt
gttaggtacctgggcgtgagtaatggtaacatgcaggaaggttcccttcgctgtgatgtg
aatgtttctgttcggccaattggacaatcaaattttggtacaaaggttgaaataaagaat
atgaattcattttctgcaataagtagggcaatagattatgagatctcccggcagattctt
cttcataaagaaggtcaggctgatcaaattgtacaagaaacccggctgtgggatgaatct
tctcagaaaacttttacaatgcgaaaaaaggagggacttgctgattatagatattttcct
gagcctgatcttcctgaagttgttcttactagtgagtacattgatgaaattcaaaactca
atgccagagcttcctgaagcaaagcgtaggcgcttcgagaatatgggactcagcatgcaa
gatgttcttttccttgctaatgacgataatgttgctcggttcttcgattctacccttgag
cacggcgcggatgcaaagctggctgccaactggatcatgggtgacattgctgcttatttg
aaaaatgaaaaactttccattgatgaaattaaattaacacctctggagctttctgaattg
attgcatctataaggaatggaactatcagtgggaagattggaaaggagattctgattgaa
ctcattgcgaaaggtggaactgtcaagtctgtgatagaggagaaagatttggttcagata
gcagatcctgcagcaattgaggcaatggtagatcaagtattagctgataatccaaagcaa
cttgagcagtatcggtccgggaaaactaaattgcaaggattttttgctggccaggtgatg
aaagcatcaaagggtaaagctaatcctgttttgttgaacaaaatcctcggggagaaattg
aaggccaatagttga

DBGET integrated database retrieval system