KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333613
Entry
4333613           CDS       T01015                                 
Name
(RefSeq) 3-isopropylmalate dehydrogenase 2, chloroplastic
  KO
K00052  3-isopropylmalate dehydrogenase [EC:1.1.1.85]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00290  Valine, leucine and isoleucine biosynthesis
osa00660  C5-Branched dibasic acid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01210  2-Oxocarboxylic acid metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    4333613
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    4333613
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.85  3-isopropylmalate dehydrogenase
     4333613
SSDB
Motif
Pfam: Iso_dh
Other DBs
NCBI-GeneID: 4333613
NCBI-ProteinID: XP_015633256
UniProt: Q10FT9 Q7Y096
LinkDB
Position
3:25586202..25590665
AA seq 408 aa
MSIQANPLIKTLALSPRRRMAPPAPATARRPMAAVRCSAAKRSYNVTLLPGDGIGPEVVA
VAKDVLSLAGALEGVEFRFQEKLMGGAAVDAYGVPLPEETLAAAQASDAVLLGAIGGYKW
DNNEKHLKPETGLLQIRAGLGVFANLRPAAVLPQLVDASTLKKEVAEGVDIMVVRELTGG
IYFGQPRGFGKNDKGEDTGFNTEVYSASEIDRITRVAFEVARKRRGKLCSVDKANVLEAS
MLWRKRVTSLASEFPDIELSHMYVDNAAMQLIRNPKQFDTIVTNNIFGDILSDEASMLTG
SIGMLPSASVGESGPGLFEPIHGSAPDIAGQDKANPLATILSAAMLLRYGLGEENAAKRV
EAAVTETLNNGFRTGDIYSPGTTLVGCKRMGEEVLKTVESQSAVALNS
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgtcaatccaagctaatcccctcatcaaaaccctagccttgtcgcctcgtcggcggatg
gcgccgccggcgccggcgacggcgcggcgcccgatggcggccgtccgctgctccgcggcg
aagaggagctacaacgtcacgctcctccccggtgacggcatcggcccggaggtggtcgcc
gtcgccaaggacgtcctctccctcgccggcgctctcgaaggcgtcgagttccgcttccag
gagaagctgatgggcggcgcggcggtggatgcgtacggcgtgccgctcccggaggagacg
ctcgcggcggcgcaggcgtcggacgccgtcctcctcggcgccataggagggtataagtgg
gataacaatgagaagcacctcaagccagagactgggttgctccagatacgcgctgggctt
ggcgtctttgctaatctgaggccagctgcagtgttgcctcagttagtagatgcatctact
ttgaaaaaagaagtagctgaaggagtcgacatcatggttgttagagagcttacaggagga
atatacttcggccaacctaggggttttggaaagaacgacaaaggagaagacactggcttc
aacactgaagtatattcagcttctgagattgatcgaatcacacgtgttgcatttgaggtt
gctcgcaagaggcgcgggaagctttgctcagtagacaaagcgaatgtgcttgaggcatct
atgctttggagaaaacgggtgacttcattagcttctgaattccctgacattgagctgtcg
cacatgtatgttgataatgcagcaatgcagcttattaggaatcctaagcagtttgacaca
attgtcacaaacaatatttttggtgacatattgtctgatgaagcatcaatgcttactgga
agcattggaatgctcccatctgccagtgttggtgaatcgggaccaggtctttttgagcct
attcatggttctgcgcccgacattgctgggcaggataaggcaaacccattagctacaatt
cttagtgctgccatgctattgcggtatggccttggagaagaaaatgctgcaaagagagtt
gaagccgcagttacagagacactaaacaacgggttccgaactggggacatatattctcct
ggaacgaccttggtcggatgcaagcgaatgggagaggaagtcctgaagactgtagagtcg
cagagcgcggttgctctaaactcgtag

DBGET integrated database retrieval system