KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333619
Entry
4333619           CDS       T01015                                 
Name
(RefSeq) TATA-binding protein 2 isoform X1
  KO
K03120  transcription initiation factor TFIID TATA-box-binding protein
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    4333619
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:osa03000]
    4333619
   03021 Transcription machinery [BR:osa03021]
    4333619
Transcription factors [BR:osa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   TATA-binding proteins
    4333619
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     4333619
  RNA polymerase III system
    TFIIIB
     4333619
  RNA polymerase I system
    SL1/TIF-1B
     4333619
SSDB
Motif
Pfam: TBP DUF3378 DUF4295
Other DBs
NCBI-GeneID: 4333619
NCBI-ProteinID: XP_015631681
UniProt: Q8W0W4
LinkDB
Position
3:25634527..25639043
AA seq 203 aa
MAAEAAAALEGSEPVDLAKHPSGIIPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRF
AAVIMRIREPKTTALIFASGKMVCTGAKSEQQSKLAARKYARIIQKLGFPAKFKDFKIQN
IVGSCDVKFPIRLEGLAYSHGAFSSYEPELFPGLIYRMKQPKIVLLIFVSGKIVLTGAKV
RDETYTAFENIYPVLTEFRKVQQ
NT seq 612 nt   +upstreamnt  +downstreamnt
atggcggcggaggcggcagcggcgctggaggggagcgagcccgtggacctggccaagcac
ccctccggcatcatccccacgctccaaaacatcgtatcgacggtcaatttggattgcaaa
ttagacctcaaagctatagctttgcaagctcgcaatgcagaatataatccaaagcgtttt
gctgcggttatcatgagaataagagaaccaaaaactacagctctgatatttgcatcgggt
aaaatggtctgtactggggcaaagagtgaacaacaatccaagcttgcagcaagaaagtac
gctcgtattatccagaagcttggctttcctgctaaattcaaggatttcaagattcagaac
attgttggctcttgtgatgttaaatttccaatcaggctggagggacttgcatattctcat
ggtgctttctcaagttatgagccagaactctttcctggtctgatatatcggatgaagcaa
ccaaagattgttcttctgatttttgtttcaggcaagattgttttgaccggagcaaaggtg
agggatgagacgtataccgcctttgagaacatataccctgtgctaacggagttcagaaaa
gtccagcagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348699
Entry
4348699           CDS       T01015                                 
Name
(RefSeq) TATA-binding protein 2-like
  KO
K03120  transcription initiation factor TFIID TATA-box-binding protein
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    4348699
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:osa03000]
    4348699
   03021 Transcription machinery [BR:osa03021]
    4348699
Transcription factors [BR:osa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   TATA-binding proteins
    4348699
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     4348699
  RNA polymerase III system
    TFIIIB
     4348699
  RNA polymerase I system
    SL1/TIF-1B
     4348699
SSDB
Motif
Pfam: TBP DUF3378 DUF4295
Other DBs
NCBI-GeneID: 4348699
NCBI-ProteinID: XP_015612909
UniProt: Q337X1 Q0IXI3
LinkDB
Position
10:complement(15424963..15430229)
AA seq 223 aa
MAAAAVDPMALGLGTSGGGGGGESAVGGDGAEPVDLVEHPSGIVPTLQNIVSTVNLDCRL
DLKKIALQARNAEYNPKRFAAVIMRIRDPKTTALIFASGKMVCTGAKSEDHSKLAARKYA
RIVQKLGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHGAFSSYEPELFPGLIYRMKQP
KIVLLIFVSGKIVLTGAKYRKEIYAAFENMFPVLTEYRKTQQR
NT seq 672 nt   +upstreamnt  +downstreamnt
atggctgccgcggcggtggatccgatggcgctggggctggggacgagcggaggaggagga
ggaggcgagtcggcggtggggggtgatggggcggagccggtggatctcgtcgagcacccc
tccgggatcgtccccaccctccagaacattgtttcgacagtaaatctggactgcaggttg
gatctgaaaaaaatcgctctacaggctcgtaatgcagagtacaacccaaagcgttttgct
gcagttatcatgaggataagggacccaaagacaacagccctgatatttgcttcgggaaag
atggtttgcactggagcaaagagcgaagaccattcaaagcttgctgcgaggaagtatgcg
cgaatcgtccaaaagcttggcttcccagcaaagttcaaggatttcaagatccagaacatt
gttggttcatgtgatgtcaaatttcctattcgcctggagggccttgcttattctcatggc
gcattctctagttatgagccagagctcttccctgggctgatttaccggatgaagcagcca
aagattgtgcttctcatttttgtctctggcaagattgttctcactggagctaagtaccgc
aaagagatttacgctgcctttgagaacatgttcccggtgctcactgaatacaggaaaact
cagcagcgctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352633
Entry
4352633           CDS       T01015                                 
Name
(RefSeq) TATA-binding protein 2-like
  KO
K03120  transcription initiation factor TFIID TATA-box-binding protein
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    4352633
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:osa03000]
    4352633
   03021 Transcription machinery [BR:osa03021]
    4352633
Transcription factors [BR:osa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   TATA-binding proteins
    4352633
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     4352633
  RNA polymerase III system
    TFIIIB
     4352633
  RNA polymerase I system
    SL1/TIF-1B
     4352633
SSDB
Motif
Pfam: TBP DUF3378 DUF4295
Other DBs
NCBI-GeneID: 4352633
NCBI-ProteinID: XP_015618516
UniProt: Q2QN41 Q0IMB8
LinkDB
Position
12:24031219..24035708
AA seq 208 aa
MAAAEAAAEAAAALEGSEPVDLVKHPSGIIPTLQNIVSTVNLDCKLDLKAIALQARNAEY
NPKRFAAVIMRIREPKTTALIFASGKMVCTGAKSEQQSKLAARKYARIIQKLGFAAKFKD
FKIQNIVGSCDVKFPIRLEGLAYSHGAFSSYEPELFPGLIYRMKQPKIVLLIFVSGKIVL
TGAKVRDETYTAFENIYPVLTEFRKVQQ
NT seq 627 nt   +upstreamnt  +downstreamnt
atggcggcggcggaggcggcggcggaggcggcggcggcgctggaggggagcgagcccgtg
gacctggtcaagcacccctccggcatcatccccacgctccaaaacatcgtgtcgacggtc
aatttggattgcaaattagacctcaaagctatagctttgcaagcacgcaatgcagaatat
aatccaaagcgttttgctgcagttatcatgagaataagagaaccgaaaactacagctctg
atatttgcatcgggtaaaatggtatgtactggggcaaagagcgaacaacaatcaaagctt
gcagcaagaaagtatgctcgtattatccaaaagcttggctttgctgctaagtttaaggac
ttcaagattcagaacattgttggttcttgtgatgttaaatttccaatcaggctggaggga
cttgcatattctcatggtgctttctcaagttatgagcctgaactctttcctggtctgata
tatcggatgaagcaaccgaagattgttcttctgatttttgtttcaggcaagattgttttg
accggagcaaaggtgagggatgagacgtataccgcctttgagaacatataccctgtgcta
acagagttcagaaaagtccagcaatga

DBGET integrated database retrieval system