KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333728
Entry
4333728           CDS       T01015                                 
Name
(RefSeq) probable ubiquitin-conjugating enzyme E2 18
  KO
K10688  ubiquitin-conjugating enzyme E2 W [EC:2.3.2.25]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4333728
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4333728
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.25  N-terminal E2 ubiquitin-conjugating enzyme
     4333728
Ubiquitin system [BR:osa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   4333728
SSDB
Motif
Pfam: UQ_con UEV UFC1 RWD Prok-E2_B
Other DBs
NCBI-GeneID: 4333728
NCBI-ProteinID: XP_015633199
UniProt: Q9AYE3 Q0DPL8
LinkDB
Position
3:complement(27111385..27116544)
AA seq 161 aa
MTSSSSPSRKVLSKIACNRLQKELAEWQVNPPSGFKHKVTDNLQRWVIEVAGAAGTLYAG
ETYQLQVDFPEHYPMEAPQVIFLHPAPMHPHIYSNGHICLDILYDSWSPAMTVSSVCISI
LSMLSSSPAKQRPADNDRYVRNCRNGRSPKETRWWFHDDKV
NT seq 486 nt   +upstreamnt  +downstreamnt
atgacgagctcctcctccccttcccgcaaggtgctgagcaagatcgcgtgcaaccggctg
cagaaggagctcgcggagtggcaggtcaaccctccctccggcttcaagcacaaggtcacc
gacaatctccagaggtgggtcatcgaggtcgcgggggctgcgggcacgctctatgccgga
gagacataccaattgcaggtggacttccctgagcattaccccatggaggctccccaggtc
atatttcttcatccagcgccaatgcatccgcacatttacagcaatgggcatatctgttta
gatatattgtatgactcgtggtcaccggcgatgaccgttagttctgtttgtatcagtatc
ttgtccatgttgtcaagctcaccagcaaagcaacgtcctgccgacaatgatcgctatgtc
aggaactgccgcaatgggaggtcgccgaaggagaccaggtggtggtttcatgatgacaaa
gtgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352894
Entry
4352894           CDS       T01015                                 
Name
(RefSeq) probable ubiquitin-conjugating enzyme E2 18
  KO
K10688  ubiquitin-conjugating enzyme E2 W [EC:2.3.2.25]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4352894
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4352894
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.25  N-terminal E2 ubiquitin-conjugating enzyme
     4352894
Ubiquitin system [BR:osa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   4352894
SSDB
Motif
Pfam: UQ_con UEV UFC1 RWD Prok-E2_B
Other DBs
NCBI-GeneID: 4352894
NCBI-ProteinID: XP_015618128
UniProt: Q2QLM1 B9GEG3
LinkDB
Position
12:complement(27295396..27298738)
AA seq 161 aa
MTSSSSPSRKALSKIACNRLQKELAEWQVSPPSGFKYRVSDNLQRWVIEVTGAAGTLYAG
ETYQLQVDFPEHYPMEAPQVIFLNPAPMHPHIYSNGHICLDILYDSWSPAMTVSSVCISI
LSMLSSSPAKQRPQDNDRYVRNCRNGRSPKETRWWFHDDKV
NT seq 486 nt   +upstreamnt  +downstreamnt
atgacgagctcctcatctccttcccgaaaggcgctgagcaagatcgcttgcaatcggctg
cagaaggagctcgccgagtggcaggtcagccctccctccgggttcaagtacagggtctcc
gataacctccaaaggtgggtaatcgaggtcaccggagcggcgggcacgctctacgccggc
gagacataccagctgcaggtcgacttccctgagcattatcccatggaggcgcctcaggtc
atttttctcaacccggcgccgatgcatccacacatttacagcaacgggcacatctgttta
gatatactgtatgattcttggtcacctgcaatgactgtcagttcggtctgcatcagcatt
ttgtcaatgttgtcaagttcaccagcaaagcaacgccctcaagacaatgaccgctatgtt
aggaattgccgcaatgggaggtcgccgaaggagaccagatggtggttccatgatgacaaa
gtgtaa

DBGET integrated database retrieval system