KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333780
Entry
4333780           CDS       T01015                                 
Name
(RefSeq) 1,4-dihydroxy-2-naphthoyl-CoA thioesterase 1
  KO
K19222  1,4-dihydroxy-2-naphthoyl-CoA hydrolase [EC:3.1.2.28]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00130  Ubiquinone and other terpenoid-quinone biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Module
osa_M00932  Phylloquinone biosynthesis, chorismate (+ phytyl-PP) => phylloquinol
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    4333780
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.28  1,4-dihydroxy-2-naphthoyl-CoA hydrolase
     4333780
SSDB
Motif
Pfam: 4HBT 4HBT_3 Cloacin
Other DBs
NCBI-GeneID: 4333780
NCBI-ProteinID: XP_015628176
UniProt: Q6AV57 A3ALL4
LinkDB
Position
3:complement(27644646..27647528)
AA seq 164 aa
MDDATSSSSRAPRPKTEELDAALHAMGFEIERVSPAEVTGRLLVTPTCCQPFKVLHGGVS
ALIAEGLASMGAHMASGYSRVAGVQLSINHFRSAALGDTVLVRAAPLHVGRSTQVWAVKL
WKLDPSTKEKGAQISESRVTLLCNLPVPESVKNAGEALKKYSKL
NT seq 495 nt   +upstreamnt  +downstreamnt
atggacgacgccacgtcgtcgtcgtcgcgggcgccgcggcccaagacggaggagctggac
gcggcgctccacgccatggggttcgagatcgagcgggtctcccccgcggaggtcaccggc
cgcctcctcgtcacccccacctgctgccagccgttcaaggtgctgcacggcggcgtgtcg
gcgctgatagcggaggggttggcgagcatgggggcgcacatggcgtcgggctacagccgc
gtcgccggcgtgcagctcagcatcaaccacttccgcagcgccgccctcggcgacaccgtc
ctcgtccgcgccgccccgctccacgtcggccgctccacccaggtgtgggcggtgaagctg
tggaaattggatccatccacgaaggagaagggggctcagatctctgaatccagggtgact
cttctctgcaatctgccggtgccggagagcgtgaaaaatgcaggggaggcgctcaagaaa
tactctaaactgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337746
Entry
4337746           CDS       T01015                                 
Name
(RefSeq) 1,4-dihydroxy-2-naphthoyl-CoA thioesterase 1
  KO
K19222  1,4-dihydroxy-2-naphthoyl-CoA hydrolase [EC:3.1.2.28]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00130  Ubiquinone and other terpenoid-quinone biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Module
osa_M00932  Phylloquinone biosynthesis, chorismate (+ phytyl-PP) => phylloquinol
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    4337746
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.28  1,4-dihydroxy-2-naphthoyl-CoA hydrolase
     4337746
SSDB
Motif
Pfam: 4HBT 4HBT_3
Other DBs
NCBI-GeneID: 4337746
NCBI-ProteinID: XP_015637751
UniProt: Q0DKX1
LinkDB
Position
5:complement(2196343..2197943)
AA seq 169 aa
MAGAGEDGKRESSWPWPPEYGPPDNALHSLGMEFTTITAGEVVGRLLVTATCCQPFKVLG
GGVSALMAEAAASIGGYIASGYRRVAGVQLSINHIRPAHLGETVQAKAKPMQLGRTIQVW
EVQIWRIDPSTSECKHLVSTARVTLLCNLPTPEDLKHYEQGFIKKHAKL
NT seq 510 nt   +upstreamnt  +downstreamnt
atggccggcgccggcgaggacggaaagagagagagtagctggccatggccgccggagtac
ggcccgccggacaatgctctgcactccctgggaatggagttcaccaccatcaccgccggc
gaggtcgtcggccgcctcctcgtcaccgccacctgctgccagccgttcaaggtgctcggc
ggcggcgtgtcggcgctgatggcggaggcggcggcgagcatcggcggctacatcgcgtcc
ggctaccggagggtcgccggcgtgcagctgtccatcaaccacatcaggccggcccacctc
ggcgagaccgtccaggcgaaggccaagcccatgcagctcggccgtaccatccaggtttgg
gaggtccagatatggcggatagatccttccacatcagagtgcaaacatctagtgtcaaca
gcaagggttaccctactatgcaacctaccaacaccagaggatttgaagcactatgaacaa
ggttttatcaagaaacatgcaaagctgtag

DBGET integrated database retrieval system