KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333797
Entry
4333797           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC4333797
  KO
K02970  small subunit ribosomal protein S21
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4333797
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4333797
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    4333797
  Bacteria
    4333797
SSDB
Motif
Pfam: Ribosomal_S21
Other DBs
NCBI-GeneID: 4333797
NCBI-ProteinID: XP_015630958
LinkDB
Position
3:complement(27819949..27822957)
AA seq 136 aa
MHRKEKIEGRSSRNATHTLGGCGGGGGREPAMQALARAARGILPATAAAPAARVQQARGI
VVHVKDGNLERALGVMARKMRSSGIERLIRARSQIHHHVKDSEKRVLARKALMQRVRSQE
LGKKLRDILIKKIRGQ
NT seq 411 nt   +upstreamnt  +downstreamnt
atgcaccgaaaggagaaaattgaagggcgtagcagccgcaacgcgacccacacactcggc
ggctgcggcggaggcggcgggagggaaccagcgatgcaggcactggcacgggcggcgcgg
gggatcctgccggcgacggcggcggcgcctgcggcgcgagtgcagcaggcgcgggggatc
gtggtacatgtgaaggacggcaacctggagcgcgcgctgggggtaatggcgcgcaagatg
cggtcgagcggcatcgagaggctgatccgggcccggagccagatccaccaccacgtcaag
gactcggagaagcgggtgctcgcccgcaaggccctcatgcagcgcgtccgctcccaggag
ctcggcaagaagctccgcgacatcctcatcaagaagatcaggggccagtga

DBGET integrated database retrieval system