KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333848
Entry
4333848           CDS       T01015                                 
Name
(RefSeq) 30S ribosomal protein S13, chloroplastic
  KO
K02952  small subunit ribosomal protein S13
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4333848
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4333848
Ribosome [BR:osa03011]
 Ribosomal proteins
  Bacteria
   Small subunit
    4333848
  Archaea
    4333848
SSDB
Motif
Pfam: Ribosomal_S13 IgaA
Other DBs
NCBI-GeneID: 4333848
NCBI-ProteinID: XP_015628848
UniProt: Q75IA5 B9FAT7
LinkDB
Position
3:28301284..28303189
AA seq 171 aa
MATLSMVSVPIATSSLPLSARGRSSSVSFPVPKKGGIGHGGLRIECIRIGGVEIPNHKRV
EYSLQYIHGIGRSRSRQILLDLNFDNKVTKDLSEEEVITLRKEVTKYMIEGDLKRFNRVA
IERLKEIRCYRGIRHKLGLPVRGQRTKNNCRTLKGRRASVAKKKSPASQEE
NT seq 516 nt   +upstreamnt  +downstreamnt
atggcgaccctctcgatggtctccgtccccatcgccacctcctccctgcccctctccgcc
cgaggccgcagctcctccgtctccttccccgttcccaagaaagggggtattggtcatggt
ggcctgcggatcgagtgcattcgtattggtggagtggagatcccgaaccacaagagggta
gagtactcactgcagtacatccatggcattgggcggtcacgctcccgtcagatcctcttg
gacctcaattttgacaacaaggtcacaaaggacctctccgaggaggaagtcatcactctc
cgtaaggaggttaccaagtacatgattgagggagaccttaaacggtttaatcgtgtggcg
attgagaggttgaaggagattaggtgttacaggggcatccgccacaagctagggctgcca
gttcgtggacagaggacgaagaacaattgcaggacgctgaagggaaggagggcttctgtt
gcgaagaagaagtcgcctgcttcccaggaggaataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 6450193
Entry
6450193           CDS       T01015                                 
Symbol
rps13, OrsajM_p31
Name
(RefSeq) ribosomal protein S13
  KO
K02952  small subunit ribosomal protein S13
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    6450193 (rps13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    6450193 (rps13)
Ribosome [BR:osa03011]
 Ribosomal proteins
  Bacteria
   Small subunit
    6450193 (rps13)
  Archaea
    6450193 (rps13)
SSDB
Motif
Pfam: Ribosomal_S13 NFACT_N HHH_5
Other DBs
NCBI-GeneID: 6450193
NCBI-ProteinID: YP_002000577
UniProt: Q8HCP0
LinkDB
Position
MT:complement(242491..242841)
AA seq 116 aa
MLYILGARLLPDEQVRIALTKMDGIGPKKAIQLCYRLGISGNIKMNELTKYQIDQIEQMI
AQDHVVHWELKRGERADIERLISISCYRGIRHQDGLPLRGQRTHTNARTARKLIRK
NT seq 351 nt   +upstreamnt  +downstreamnt
atgtcatatatctcaggagctagatcacttcccgatgaacaagtcagaattgcctcaaca
aaaatggatggaattggaccgaaaaaagccattcagcttcgttatcgattaggtatcagt
gggaacatcaagatgaatgagttaactaagtatcagatcgaccaaattgaacaaatgata
gctcaagatcatgttgttcattgggaattgaagaggggagaacgagcagacatcgaacga
ttaatttctatttctcgttatcgtggaattcgtcatcaagatggatcgcccttacgcggt
caacgaactcatactaatgcaaggactgctcgcaagctaattcggaaatga

DBGET integrated database retrieval system