KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333866
Entry
4333866           CDS       T01015                                 
Name
(RefSeq) DEAD-box ATP-dependent RNA helicase 21
  KO
K12858  ATP-dependent RNA helicase DDX23/PRP28 [EC:3.6.4.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4333866
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4333866
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     4333866
Spliceosome [BR:osa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U5 snRNP specific factors
    4333866
 Complex C
   U5 SnRNP specific factors
    4333866
SSDB
Motif
Pfam: DEAD Helicase_C ResIII
Other DBs
NCBI-GeneID: 4333866
NCBI-ProteinID: XP_015631547
UniProt: Q53RK8
LinkDB
Position
3:complement(28567076..28571315)
AA seq 736 aa
MKRAADGMEKPKFLTREEREKLALERRQAAVTDQRRSALDLLQSLPRPPPPPPPPLSNPP
RDSSSSHHRDSSDRDRDRDRDRDRDRDRDRDRERRRDDDSRRDRDRDRDRDRGDSSRRDR
DRERGDRDRDRDRERGDRDRERGDREKDRLEKMAEREREKELDAIKEQYLGSKKPKKRVI
KPSEKFRFSFDWENTEDTSRDMNSLYQSPHEARLLYGRGFLAGIDRREQKKVAAAHEKET
RAEQRRKAGLDDRPEDDAVDKKEADAAAKYDAFDMRVDRHWTQKSLDEMTERDWRIFRED
FNISYKGSKVPRPMRKWSESKLGTELLRAVEKAGYKEPSPIQMASIPLGLQQRDVIGIAE
TGSGKTAAFVLPMLSYITRLPPISEENEAEGPYAVVMAPTRELAQQIEEETVKFATYLGI
KVVSIVGGQSIEEQGFKIRQGCEVVIATPGRLLDCLERRYAVLNQCNYVVLDEADRMIDM
GFEPQVVGVLDAMPSSNLKPENEDEELDAKTIYRTTYMFSATMPPAVERLARKYLRNPVV
VTIGTAGKATDLITQNVIMTKESEKMSRLQKILTDLGDKPAIVFCNTKKSADARAKDLDK
AGFRVTTLHGGKSQEQRETSLDGFRNRRFTVLVATDVAGRGIDIPDVAHVINYEMPSSID
TYTHRIGRTGRAGKKGLATSFLTLENTDIFFDLKQMLIQSNSPVPPELARHEASKFKPGS
VPDRPPRRNDTVYATH
NT seq 2211 nt   +upstreamnt  +downstreamnt
atgaagcgcgccgccgacgggatggagaagcccaagttcctcacgcgggaggagcgggag
aagctggcgctcgagcgccgccaggccgccgtcaccgaccagcgccgctccgccctcgac
ctgctccagtcgctcccccgcccccctccgccgccgccgcctcccctttccaacccccct
cgcgactcctcctcctcccaccaccgcgactcctccgaccgtgaccgtgaccgtgaccgg
gaccgggatcgggacagggaccgggaccgtgaccgggagcgccgccgcgacgacgactcc
cgccgcgaccgagatcgggatcgggaccgcgaccgaggcgactcctcccgccgcgaccgc
gacagggagcgcggtgaccgcgaccgcgaccgtgaccgggagcgcggggacagggacagg
gagcgaggggacagggagaaagatcggctggagaagatggcggagagggagcgggagaag
gagctggacgcgatcaaggagcagtacctgggttccaagaagcccaagaagcgggtcatc
aagccgtctgagaagttccgcttctcgttcgactgggagaacacggaggacaccagccgc
gacatgaactcgctctaccagtcgccccacgaggcccgcctgctctacggccggggattc
ctggctggcattgatcgccgcgagcagaagaaggtggccgccgcgcatgagaaggagacc
cgtgccgagcagcggcgcaaggccggtctggatgaccgccctgaggacgacgcagttgat
aagaaggaggctgatgctgcagcgaagtatgatgccttcgacatgcgcgtggacaggcac
tggactcagaagtctcttgatgagatgacggagcgggattggcgtatattccgtgaggac
ttcaatatatcctataagggttctaaggtaccccgtcccatgcggaagtggtctgagagc
aagcttggtactgagctgcttcgtgctgtcgagaaagctgggtacaaggaaccttcgccg
attcagatggcttccattccacttggtctccagcagcgtgatgttattggtattgctgaa
acaggctctggcaagactgctgcttttgtgctccctatgctttcgtacattacccgcctc
ccacccataagtgaggaaaatgaggctgagggtccttatgctgttgttatggcacctact
cgtgagcttgctcaacagattgaggaagagactgtgaaatttgcgacctatcttggcatt
aaggttgtgtctatcgttggtggtcaatccattgaagagcagggttttaagattaggcag
ggctgtgaggttgttattgcaactcctggtcggcttcttgattgcttggagaggaggtat
gctgtgctcaaccagtgcaactatgtggttctggatgaggctgataggatgattgatatg
ggcttcgagccgcaggttgttggagtccttgatgctatgccatcgagtaacttgaaacct
gagaatgaggatgaggagcttgatgcaaaaacgatctataggactacctatatgttcagc
gccactatgccacctgctgtggagcggcttgctaggaagtacctgcggaacccagtcgtt
gtcacaattggtacagctggcaaggccacagatctcatcacacagaacgtgatcatgacg
aaggagtcagagaagatgtcaaggctccagaagatactcacagatcttggggataagcca
gccattgtgttctgcaacacaaagaaatcagcagatgctcgtgcgaaggatctagacaag
gcaggcttccgcgtcacaacactacatggtgggaagtcacaggagcagagagagacgagc
cttgatggatttagaaaccggcggttcactgttcttgtggcaactgatgttgccgggcgt
ggtattgatattcccgatgttgctcatgtcatcaactatgagatgcctagttcaatcgat
acatacacacatcgtattggaagaactggacgtgcaggaaagaagggattggcaacttcg
tttttaactctggagaacactgacattttctttgatctgaaacagatgcttatacagagc
aacagtcctgtgccacctgaacttgcaaggcatgaagcatccaaatttaagccaggctca
gttcctgatagacctccaagacgaaatgacacagtctatgcaactcactga

DBGET integrated database retrieval system