KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334003
Entry
4334003           CDS       T01015                                 
Name
(RefSeq) 4-hydroxy-3-methylbut-2-enyl diphosphate reductase, chloroplastic
  KO
K03527  4-hydroxy-3-methylbut-2-en-1-yl diphosphate reductase [EC:1.17.7.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00900  Terpenoid backbone biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    4334003
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.7  With an iron-sulfur protein as acceptor
    1.17.7.4  4-hydroxy-3-methylbut-2-en-1-yl diphosphate reductase
     4334003
SSDB
Motif
Pfam: LYTB DUF3574 SR-25
Other DBs
NCBI-GeneID: 4334003
NCBI-ProteinID: XP_015632597
UniProt: Q6AVG6
LinkDB
Position
3:complement(29950619..29953906)
AA seq 459 aa
MATITTQLRSALLSPAASPSRRARRAPSSVRCDSSAASSLSASASLDADFDKKQFRHNLT
RSDNYNRKGFGHKKETLELMSQEYTSDVIKTLKENGNQHTWGPVTVKLAEAYGFCWGVER
AVQIAYEARKQFPDDRIWLTNEIIHNPTVNKRLEDMGVQNIPVDAGIKDFDVVEQGDVVV
LPAFGAAVEEMYTLNEKKVQIVDTTCPWVSKVWNMVEKHKKGDYTSIIHGKYSHEETVAT
ASFAGTYIIVKNIAEASYVCDYILGGQLDGSSSTKEEFLEKFKNAVSPGFDPDVDLVKVG
IANQTTMLKGETEEIGKLVEKTMMRRFGVENVNDHFIAFNTICDATQERQDAMYQLVKEK
VDLILVVGGWNSSNTSHLQEIGELSGIPSYWIDSEQRIGPGNKISYKLNHGELVEKENWL
PEGPITIGVTSGASTPDKVVEDALQKVFEIKRQEVLQAA
NT seq 1380 nt   +upstreamnt  +downstreamnt
atggcgaccatcaccacgcagctccggtcggccctcctctcgccggcggcctcgccgagc
cgccgtgccaggcgcgccccgtcgtccgtgcggtgcgactcctcggcagcgtcgtccctg
tccgcctccgcgtcgctcgacgccgacttcgacaagaagcagttccgccacaacctcacc
cgcagcgacaactacaaccgcaagggcttcggccacaagaaggagacgctcgagctcatg
agccaggagtacaccagcgacgtgatcaagacgctcaaggagaacgggaaccagcacacg
tggggccccgtgacggtgaagctggcggaggcgtacggcttctgctggggcgtcgagcgc
gccgtgcagatcgcctacgaggcgcgcaagcagttccccgacgatcgcatctggctcacc
aacgagatcatccacaaccccaccgtcaacaagcgattggaggacatgggcgtccaaaac
attcctgttgatgcaggtattaaggatttcgatgttgtcgagcaaggggatgttgtcgta
ttgcctgcatttggagcggccgtggaggagatgtacacgctgaatgagaagaaggtgcag
atagtcgatacaacgtgcccttgggtttcaaaggtgtggaacatggttgaaaagcacaag
aagggtgactacacttctattattcatggaaaatactcccatgaagaaactgttgccact
gcttcctttgcagggacatacatcattgttaagaacatagcagaggctagctatgtatgt
gattatatacttggtggccaacttgatggttctagctccacaaaagaggagttccttgag
aaattcaaaaatgctgtttctccaggatttgatcctgatgttgacttagtgaaagttggc
attgccaatcaaacaacaatgcttaaaggagaaactgaagaaattgggaagcttgttgag
aagacaatgatgcgtaggtttggagttgagaatgtcaatgaccacttcattgccttcaac
actatctgtgatgccacacaggaaagacaagatgcaatgtaccagctagtgaaggagaaa
gttgatcttattctggttgttggaggatggaactccagtaacacctctcatttgcaagaa
attggagaactcagtggaattccgtcttactggattgacagtgaacaaaggattggacct
ggaaacaagatcagctacaagttaaatcatggcgagcttgtcgagaaagagaactggtta
ccagaaggccctatcacaatcggagttacttctggcgcctcaactccggacaaggttgtt
gaggatgcgttacagaaggtgtttgagatcaagcgccaggaagttttgcaggccgcgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334004
Entry
4334004           CDS       T01015                                 
Name
(RefSeq) 4-hydroxy-3-methylbut-2-enyl diphosphate reductase, chloroplastic-like
  KO
K03527  4-hydroxy-3-methylbut-2-en-1-yl diphosphate reductase [EC:1.17.7.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00900  Terpenoid backbone biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    4334004
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.7  With an iron-sulfur protein as acceptor
    1.17.7.4  4-hydroxy-3-methylbut-2-en-1-yl diphosphate reductase
     4334004
SSDB
Motif
Pfam: LYTB
Other DBs
NCBI-GeneID: 4334004
NCBI-ProteinID: XP_015629935
LinkDB
Position
3:complement(29956753..29973141)
AA seq 374 aa
MERNGGEYVTMDGLVRLILAEAHGFCLGVDNAVRLAYDARVKFPDRRLWLTNQIIHNPTV
SERLDEMGIKIIPVVSGVKDLSVVEDGDVVIFPAFGFTVDEMVTLNRKNVHIVDTTCPLV
LKVVHMTERHIKGNYTTIIHGKYAHEETVATASFADKYIIVKDITEAKYVCDYILEGQLD
GSSSTKEKFLKKFRYAVSPGFDPDIDLERVGVVNQTTMLKGETKEIGILIEQTMMSKYGL
DQNNKQEHFVRVGTICNATQERQDAMYKLVEKEVDLILVVGGWNSSNTSHLQEIGELSGI
PSYWVDGEQRIGPGNKISYKQKNGELVEKDKWLPHGAITIGVTSGASTPDKVVEDVLQKV
FEIKRQELGEATEQ
NT seq 1125 nt   +upstreamnt  +downstreamnt
atggagaggaacgggggagagtacgtgaccatggacgggttggtgaggctgatcctggcc
gaggcgcacggcttctgcctcggcgtcgacaacgccgtgcgcctcgcgtacgacgcgcgc
gtcaagtttcccgaccggcggctgtggctcactaaccagatcatccacaacccaaccgtc
agcgagagattggatgagatgggaatcaaaatcatcccggttgtttccggtgtaaaagat
ttgagtgttgttgaagatggcgatgtggtcatttttccagcgtttggatttacagtggat
gagatggtcacgctaaacaggaagaacgtgcacatagttgacacaacctgccctttggtc
ctaaaggttgtgcacatgacagaaaggcatataaagggtaactacactacgattatccat
ggaaaatatgcccacgaagagactgttgcaaccgcctcttttgcagacaagtacatcatt
gtgaaggacataactgaggcaaagtatgtgtgtgattacattcttgaaggccaacttgat
gggtccagctcaacaaaagagaagttccttaagaaattcagatatgctgtctctccagga
tttgaccctgatattgacttggagagagtaggcgttgtgaatcaaacaacaatgcttaaa
ggagaaactaaagaaattggaatactcattgagcagacaatgatgagtaagtatggtctt
gatcagaacaacaagcaagaacatttcgtcagagtcggcaccatttgcaatgctactcag
gaaaggcaggatgcgatgtacaaattggtagagaaggaagttgacctcatacttgtcgtc
ggaggatggaactccagtaacacctcccatttgcaagaaattggagaactcagtggcatt
ccttcctactgggtcgatggtgagcagaggattgggccagggaacaagatcagctacaaa
caaaagaatggtgaacttgttgagaaagacaaatggttaccccatggagcaatcacaatt
ggagtcacctctggagcctctactccagacaaggtcgttgaggatgtgctgcagaaggtg
tttgagataaagcgtcaggagcttggtgaagcgacagagcaatag

DBGET integrated database retrieval system