KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334073
Entry
4334073           CDS       T01015                                 
Name
(RefSeq) ATP-sulfurylase 3, chloroplastic
  KO
K13811  3'-phosphoadenosine 5'-phosphosulfate synthase [EC:2.7.7.4 2.7.1.25]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa00261  Monobactam biosynthesis
osa00450  Selenocompound metabolism
osa00920  Sulfur metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    4334073
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4334073
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    4334073
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    4334073
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.25  adenylyl-sulfate kinase
     4334073
   2.7.7  Nucleotidyltransferases
    2.7.7.4  sulfate adenylyltransferase
     4334073
SSDB
Motif
Pfam: ATP-sulfurylase PUA_2
Other DBs
NCBI-GeneID: 4334073
NCBI-ProteinID: XP_015631546
UniProt: Q84MN8 A0A0N7KI12
LinkDB
Position
3:complement(30532235..30535419)
AA seq 477 aa
MAMQAAFAASMFPQLAQRRGSDRAVVVAPPAPAPVRVAMRSGGAAAAAARGVRCRASLIE
PDGGRLVELVVPEEGGRREAARREAAALAHRVRLGRVETEWLHVLSEGWASPLRGFMREA
EFLQALHFNAIRGGDGAMVNMSVPIVLPLGDAQRRAIEASGARRVALVDAADRPLAVLSD
IEIYKHNKEERIARTWGTTAPGLPYVDEAITNAGDWLIGGDLEVIEPIKYNDGLDQYRLS
PAQLREEFARRNADAVFAFQLRNPVHNGHALLMTDTRKRLLEMGYKNPVLLLHPLGGFTK
ADDVPLSWRMKQHEKVLEEGVLNPESTVVAIFPSPMHYAGPTEVQWHAKARINAGANFYI
VGRDPAGMGHPTEKRDLYDADHGKKVLSMAPGLEKLNILPFKVAAYDTKQKKMDFFDPSR
KDDFLFISGTKMRTLAKNCQSPPDGFMCPGGWKVLVEYYDSLTPSADSSKLREAVAA
NT seq 1434 nt   +upstreamnt  +downstreamnt
atggcgatgcaggccgccttcgccgcctcgatgttcccgcagctggcgcagcggagggga
agcgatcgcgcggtggtggtggcgccgccggcgccggcgccggtgagggtggcgatgagg
agcggtggggcggcggcggcggcggcgagaggggtgaggtgcagggcgagcctgatcgag
cccgacggggggaggctggtggagctggtggtgccggaggagggagggcggcgggaggcg
gcgcggcgggaggcggcggcgctggcgcaccgggtgaggctggggcgggtggagacggag
tggctgcacgtgctgagcgaagggtgggcgagcccgctgcgagggttcatgcgcgaggcc
gagttcctccaagcacttcatttcaacgccatccgcggcggagacggggccatggtcaac
atgtccgtgcccatcgtcctccccctcggtgacgcccagcgccgcgccatcgaggcgtcc
ggcgcccgccgcgtcgcgctcgtcgacgccgccgaccgccccctcgccgtcctcagcgac
attgagatctacaagcataacaaagaagaaaggattgcacggacatggggaacaactgca
cctgggctgccttatgttgatgaggcgattacaaatgctggtgattggttaattggtggt
gacttggaggttatagaaccaatcaagtacaatgatggtcttgatcagtatcgcttgtct
ccagcccagctgcgtgaagagtttgccagacgcaatgctgatgcggtattcgcgtttcag
cttcgcaatcctgtacacaatggacatgctttgctcatgactgatacacgcaaacgcctt
cttgagatgggttacaaaaatcctgttcttctgcttcatccattgggaggattcacaaaa
gcagatgatgtgcctcttagttggagaatgaagcagcatgaaaaggttcttgaggaaggt
gtcctcaacccagaatcaactgtcgttgcaatcttcccctctccaatgcattatgcaggg
ccaactgaagtgcaatggcatgctaaggctcgtataaatgctggtgcaaacttctacata
gttggaagagatcctgctggtatgggccacccaactgaaaagagggacctgtatgatgct
gatcatgggaaaaaggtgttgagcatggctcctgggcttgagaagctcaatatccttcct
ttcaaggtggctgcatatgacacaaagcaaaagaaaatggactttttcgatccatcaagg
aaagatgatttcctgttcatctctggcacaaagatgcgtactcttgccaagaactgccag
agcccccctgacggattcatgtgcccgggtggctggaaggtccttgttgaatactacgac
agcttgacgccatcagcggacagcagcaaactgcgcgaggcggttgcggcctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334932
Entry
4334932           CDS       T01015                                 
Name
(RefSeq) LOW QUALITY PROTEIN: ATP sulfurylase 2
  KO
K13811  3'-phosphoadenosine 5'-phosphosulfate synthase [EC:2.7.7.4 2.7.1.25]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa00261  Monobactam biosynthesis
osa00450  Selenocompound metabolism
osa00920  Sulfur metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    4334932
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4334932
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    4334932
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    4334932
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.25  adenylyl-sulfate kinase
     4334932
   2.7.7  Nucleotidyltransferases
    2.7.7.4  sulfate adenylyltransferase
     4334932
SSDB
Motif
Pfam: ATP-sulfurylase PUA_2
Other DBs
NCBI-GeneID: 4334932
NCBI-ProteinID: XP_015635458
LinkDB
Position
4:complement(646157..650052)
AA seq 474 aa
MATTTHLHLPNPIPPRLHASPPARLRASASLAHPRLLSGLRLSAPRPRPRHGRRAMSVTV
RSSLIDPDGGALVDLVAAPGRRXALRGEAEALPRVRLAPVDVEWAHVLAEGWASPLRGFM
REHEYLQSLHFNCIRLPDGAGVVNMSLPIVLAIGDREKEEIGSSPDVALHGPDGAVLAIL
RRVEIYPHNKEERIARTWGTTAPGLPYVDEAIAQAGNWLIGGDLEVIEPIKYNDGLDHYR
LSPQQLRNEFDKRGADAVFAFQLRNPVHNGHALLMNDTRRRLLEMGFKNPILLLHPLGGF
TKADDVPLPVRMEQHSKVLEDGVLDPETTIVSIFPSPMHYAGPTEVQWHAKARINAGANF
YIVGRDPAGMGHPTEKRDLYNPDHGKKVLSMAPGLEKLNILPFKVAAYDTVAKKMAFFDP
SRSKDFLFISGTKMRAFAKSGENPPDGFMCPGGWKVLVDYYNSLQTEEAAVATV
NT seq 1425 nt   +upstreamnt  +downstreamnt
atggccaccaccacccacctccaccttcccaaccccatccctccccgcctccacgcctcc
ccgcccgcgcgcctccgcgcctccgcctcgctcgcccacccgcgcctcctctccggcctc
cgcctctccgcgccgcgcccgcgcccgcgccacggccgccgcgccatgtccgtcaccgtc
cggagctccctcatcgacccggacgggggcgcgctcgtcgacctcgtggcggcgccgggg
cgccgcnnggcgctgcgcggcgaggcggaggcgctcccgcgcgtccgcctcgcccccgtc
gacgtggagtgggcgcacgtgctcgccgaggggtgggcgagcccgctgcgggggttcatg
cgggagcacgagtacctccagtcgctgcacttcaactgcatccgcctccccgacggcgcg
ggcgtcgtcaacatgtcgctccccatcgtcctcgccatcggcgaccgggagaaggaggag
atcgggtccagcccggacgtcgcgctccatggccccgacggcgccgtcctcgccatccta
cgcagggtggaaatataccctcacaacaaagaagaaagaatagcaagaacatgggggaca
accgcacctggtttaccttatgtagatgaggcaatagcccaagctgggaactggctaatt
ggtggtgatctggaagtgattgaacccatcaaatataacgatggtcttgatcactatagg
ctctcaccccagcaacttaggaatgaattcgataagcgaggggctgatgctgtgtttgcc
ttccaattgagaaatccagtacataatgggcatgccctgttgatgaatgatactagaagg
cgcctcttggaaatgggcttcaagaatcccattctactgctgcaccctttaggtggcttc
acgaaagctgatgatgtcccgttgcctgtgagaatggaacaacacagcaaggttttagaa
gatggtgtccttgatcctgagactactatagtgtctattttcccctccccgatgcattat
gctggtccaacagaagtgcaatggcatgcaaaggcacggattaacgctggtgccaatttc
tacattgtgggtcgtgatccagctggaatgggccatccaacagaaaagagggatctgtac
aacccagatcatggaaagaaggtccttagcatggccccaggtttagagaaactcaacata
ttgcccttcaaggtagcagcatatgatacagtggcgaagaagatggcgttctttgatcct
tcacggagtaaagattttctgttcatctcaggaaccaagatgcgggcttttgcgaaaagt
ggagagaaccctcctgacggtttcatgtgccctggtgggtggaaagttcttgtggactac
tacaatagtttgcaaaccgaagaagcggctgtggcaactgtatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343681
Entry
4343681           CDS       T01015                                 
Name
(RefSeq) adenylyl-sulfate kinase 3
  KO
K00860  adenylylsulfate kinase [EC:2.7.1.25]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa00920  Sulfur metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    4343681
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4343681
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.25  adenylyl-sulfate kinase
     4343681
SSDB
Motif
Pfam: APS_kinase AAA_33 ABC_tran AAA_18 AAA_16 KTI12 AAA_29 NACHT SWI2_SNF2 CbiA Zeta_toxin AAA_30 MeaB T2SSE AAA_22 RNA_helicase AAA_17 RsgA_GTPase DUF2075
Other DBs
NCBI-GeneID: 4343681
NCBI-ProteinID: XP_015648004
UniProt: Q0D595
LinkDB
Position
7:23160246..23164648
AA seq 345 aa
MEASLPFHHHHPAASSTAAHHAARLTPPPPPRDPRATARWVPPAAAPVRSRSPANLGLPP
HPPRRLRLRLAPPRITAAVTGGPRRPRRRAPPPLECAGGSSSSLRRPREEEEEEEEEERS
STAHAGVSLVGENKVLQMSSIVPKASNIFWHDCAVGQADRQKLLKQKGCVVWITGLSGSG
KSTLACTLDRELHTRGKLSYVLDGDNLRHGLNKDLGFKAEDRAENIRRVGEVAKLFADAG
LVCIASFISPYRRDRESCRALLSDGSFIEVFLNMPLELCESRDPKGLYKLARAGKIKGFT
GIDDPYESPLNSEIEIKEVDGVCPSPSDMAGQVVTYLEEKGFLHD
NT seq 1038 nt   +upstreamnt  +downstreamnt
atggaggcctctctcccgtttcaccaccaccaccccgctgcctcctccaccgcggcgcat
cacgcggcccgcctcactcctcctcctcctccgcgagacccgcgtgccactgcccgctgg
gtgccccccgcggccgcgcccgtgcggagccggagcccggcaaatctagggttgccgccc
catcctccccgacgcctccgcctccgcctcgcgccgccgaggataaccgctgcagtcacg
ggagggccgcgtcgcccccgccgccgagccccgcctcccttggaatgcgccggcggcagc
agcagcagcctacgacgaccgcgtgaggaggaggaggaggaggaggaggaggagcgctct
tcgacggcgcacgcgggggtgagcctagtgggcgagaacaaagttttgcaaatgtcatca
attgtgccgaaggcgtccaatatcttctggcatgattgtgcagttggccaggctgatcgg
cagaagctactgaagcagaaaggttgcgttgtttggatcacaggacttagtggttcaggt
aaaagtaccctggcatgcacattagatcgagagctccatacaagagggaagctttcttat
gttcttgatggtgataatttaagacatggtttgaacaaggatcttggctttaaggcggaa
gaccgtgctgaaaatatacgcagagttggtgaggtagcaaagctattcgcagatgcaggc
ctagtatgcattgcaagtttcatatctccgtataggagagaccgtgagtcttgtcgtgca
ttattgtcagatggtagctttattgaagttttcttgaacatgcccttggaattgtgtgag
tcaagggatcctaagggcctttataagcttgctcgtgcaggaaaaataaagggttttact
ggaattgatgacccttatgaatcaccattaaactctgagattgagatcaaagaagtggat
ggtgtatgcccttcaccatcggacatggcaggacaagtagtcacttatctagaggagaaa
gggtttctgcatgattag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350977
Entry
4350977           CDS       T01015                                 
Name
(RefSeq) adenylyl-sulfate kinase 3
  KO
K00860  adenylylsulfate kinase [EC:2.7.1.25]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa00920  Sulfur metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    4350977
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4350977
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.25  adenylyl-sulfate kinase
     4350977
SSDB
Motif
Pfam: APS_kinase AAA_33 AAA_18 ABC_tran CbiA SWI2_SNF2 AAA_29 AAA_16 NACHT MeaB KTI12 Zeta_toxin T2SSE DUF2075 AAA_17 TIP49 RNA_helicase AAA_22 AAA_25 Rad17 SRP54 AAA_30 ParA AAA_23 NTPase_1 DUF463 RsgA_GTPase NB-ARC
Other DBs
NCBI-GeneID: 4350977
NCBI-ProteinID: XP_015617905
UniProt: A0A8J8YRU6 Q2R0R8
LinkDB
Position
11:24988957..24993476
AA seq 304 aa
MLARDLPIPCSGAGGRRAPAAAADGRLAGGVLRPPWGGVAAGVRLVAAARPMSVVTAAAA
GSSWDRKAGRSEAAVPAAAPVDGKDDDDVLPVLNKLMTSTVGKSTNIRWHDCPVNQLDRQ
KLLNQKGCVVWITGLSGSGKSTLACALSRELHSRGHLTYVLDGDNLRHGLNKDLSFKAKD
RAENIRRVGEVAKLFADAGLICITSLISPYKSDRSACRKLLPNSSFIEVFLNVPLEVCEE
RDPKGLYKLARAGKIKGFTGIDDPYETPSDCEIVIQCKVGDCPSPKSMADQVVSYLEANG
FFQN
NT seq 915 nt   +upstreamnt  +downstreamnt
atgcttgccagggatctccccatcccgtgctccggcgccggcggccgccgtgcaccggcg
gctgctgccgatggccgcctcgccggaggggtactgaggccaccgtggggaggagtagct
gccggcgtgaggctcgtcgcagcggcgaggccaatgagcgtcgtgacggcggcggcggcc
ggaagcagctgggacaggaaggctggccggtcggaggcggccgtgccggcggcggcgccg
gtcgacgggaaggacgacgacgatgtgttgccagttttaaacaagctcatgacctcaact
gtcggtaaatcaacaaacatccgatggcatgactgcccagtaaaccagcttgacagacaa
aagttgctgaaccagaagggctgtgttgtttggatcactggcctaagtggttcaggaaaa
agcacccttgcatgtgcactgagccgtgagctgcactcaagagggcatctgacctatgtt
cttgacggcgacaatctccggcacggcctgaacaaagatctcagcttcaaagccaaggat
cgtgccgaaaatatacgcagagttggagaagtggcaaagctgtttgcagatgctggattg
atctgcattactagtttgatatcaccctataagagtgatcgaagcgcctgccgcaaatta
ctacccaattcttcgttcattgaggtgttcctgaatgtcccacttgaagtatgtgaagaa
agggatccaaaaggcctgtacaagcttgctcgtgccggcaaaatcaaaggctttacggga
atagatgatccttatgaaacaccttcagattgtgagattgtgatacagtgcaaagttggg
gactgcccttcacctaaatcaatggctgatcaagtagtgtcatatcttgaagccaatgga
ttctttcagaactag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9272308
Entry
9272308           CDS       T01015                                 
Name
(RefSeq) adenylyl-sulfate kinase 3
  KO
K00860  adenylylsulfate kinase [EC:2.7.1.25]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa00920  Sulfur metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    9272308
  09104 Nucleotide metabolism
   00230 Purine metabolism
    9272308
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.25  adenylyl-sulfate kinase
     9272308
SSDB
Motif
Pfam: APS_kinase AAA_33 AAA_18 ABC_tran AAA_29 AAA_16 NACHT KTI12 Zeta_toxin SWI2_SNF2 CbiA AAA_17 AAA_22 MeaB RNA_helicase Herpes_Helicase AAA_23 Thymidylate_kin T2SSE AAA_24 DUF2075
Other DBs
NCBI-GeneID: 9272308
NCBI-ProteinID: XP_015628374
UniProt: A0A0P0VUL6
LinkDB
Position
3:complement(5341099..5347123)
AA seq 275 aa
MPSHAIPSPLLRARPPAPSAAAAAATGRRAPSRVVAALGGGGPAGRGMEQQQQLAGDGSR
SPVKEKPLVSTIGKSTNILWHNCPIGQSERQNLLGQKGCVIWITGLSGSGKSTLACALNR
ELHCSGHLTYVLDGDNLRHGLNRDLSFKAEDRAENIRRVGEVAKLFADAGIICIASLISP
YRRDRDACRVLLPESRFIEVFMDLPLEICEARDPKGLYKLARSGKIKGFTGIDDPYESPV
NSEIVIKMVDGECPSPKAMAQHVLCYLEENGYLQA
NT seq 828 nt   +upstreamnt  +downstreamnt
atgccctcgcacgcgatcccctccccgcttctgcgagcgcggcccccggcaccctcggcg
gcggcggccgcggcgaccgggaggagggccccgtcgcgtgtggtggcggcattgggcgga
ggcggcccggccgggagagggatggagcagcagcagcagctcgccggggacggctcccgc
agcccagttaaagagaagcctctagtgtcaaccattgggaaatcaaccaatatactgtgg
cacaattgcccaattggacaatctgagaggcagaacttgttggggcaaaaaggatgtgtc
atttggatcacaggactcagcggctcagggaaaagcactcttgcatgtgcactgaatcgg
gagttgcattgcagcggccaccttacttatgtccttgatggtgacaacctaaggcatggc
ctaaatcgagatctaagcttcaaggcagaagaccgtgcagaaaatatacgaagagttgga
gaagtggcaaagctattcgcagatgctggaatcatatgcattgctagtttgatatctcca
tataggagagaccgtgatgcgtgccgtgtgctgcttccagagtctagatttattgaagta
tttatggatttgccactagaaatttgtgaagctcgtgatcctaaaggtctatacaagctt
gcacgctctggaaagattaaaggcttcactggaattgatgatccatatgaatcaccagtg
aatagtgagatagtaattaagatggtagatggggaatgtccttcacccaaagcaatggcc
cagcatgttctgtgctaccttgaagagaacggatatttgcaagcttag

DBGET integrated database retrieval system