KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334154
Entry
4334154           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L13a-4
  KO
K02872  large subunit ribosomal protein L13Ae
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4334154
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4334154
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4334154
SSDB
Motif
Pfam: Ribosomal_L13
Other DBs
NCBI-GeneID: 4334154
NCBI-ProteinID: XP_015632279
UniProt: Q75J18 A3AMU0
LinkDB
Position
3:31203301..31205307
AA seq 206 aa
MVSGSGVCAPRVVVDARHHMLGRLASIIAKELLNGQRVVVVRCEEICMSGGLVRQKMKYL
RFLRKRMNTKPSHGPIHFRSPAKILWRTVRGMIPHKTKRGEAALARLKAYEGVPPPYDRT
KRMVIPDALKVLRLQPGHKYCLLGQLSKEVGWNYYDTIRELEEKRKEKAKVAYDRRKQLA
KLRVKAEKAAEEKLGPQLEILAPIKY
NT seq 621 nt   +upstreamnt  +downstreamnt
atggtgtccggctccggcgtgtgcgcgccgcgcgtggtggtggacgcgcgccaccacatg
ctcggccgcctggcctccatcatcgccaaggagctcctcaacgggcagcgcgtggtggtc
gtccgctgcgaggagatctgcatgtccggcggcctcgtccgccagaagatgaagtacctc
cgcttcctccgcaagaggatgaacaccaagccctcccatggccccatccacttccgctcc
cccgccaagatcctctggcgcaccgtccgcggcatgatcccgcacaagaccaagagggga
gaggcggcgctggcaaggctgaaggcgtacgagggcgtgccgccgccgtacgacaggacc
aagcgcatggtcatccccgacgcgctcaaggttctgaggctgcagcctgggcacaagtac
tgcctcctcggccagctctccaaggaggttggctggaactactatgacaccatcagggag
cttgaggagaagaggaaggagaaggccaaggttgcctatgacaggaggaagcaactggcg
aagctgcgtgtcaaggctgagaaggcagccgaggagaagctgggtcctcagctggagatt
cttgctccgatcaaatactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342219
Entry
4342219           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L13a-2
  KO
K02872  large subunit ribosomal protein L13Ae
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4342219
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4342219
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4342219
SSDB
Motif
Pfam: Ribosomal_L13
Other DBs
NCBI-GeneID: 4342219
NCBI-ProteinID: XP_015646824
UniProt: Q0D935 Q7F225
LinkDB
Position
7:complement(523744..525790)
AA seq 206 aa
MVSGSGLCTRRVVVDARHHMLGRLASLVAKELLNGQRVVVVRCEEMCISGGLVRQKMKYL
RFLRKRMNTKPSHGPIHFRAPSRIFWRTVRGMIPHKTPRGEAALANLKAFDGVPPPYDRT
KRMVVPDALKVLRLQPGHKYCLLGQLSKEVGWNYHDTIRELEEKRKEKAKVAYERRKQLT
RLRVKAEKAAEEKLGSQIDILAPIKY
NT seq 621 nt   +upstreamnt  +downstreamnt
atggtgtcgggttcggggctgtgcacgcggcgggtggtggtggacgcgcggcaccacatg
ctggggcggctggcgtcgctggtggcgaaggagctcctgaacgggcagcgggtggtggtg
gtgcggtgcgaggagatgtgcatctccggcgggctcgtccggcagaagatgaagtacctc
cggttcctccgcaagcggatgaacaccaagccctcccatggccccatccacttccgcgcc
ccctcccgcatcttctggcgcaccgtccgcggcatgatcccccacaagaccccccgcggc
gaggccgccctcgccaacctcaaggccttcgacggcgtcccccctccctacgaccgcacc
aagcgcatggtcgtccccgacgccctcaaggttcttcgcctccagcccggccacaagtac
tgcctcctcggccagctctccaaggaggtcggctggaactaccacgacaccatcagggaa
ttggaggagaagagaaaggagaaggctaaggttgcatacgagaggaggaagcaattaaca
aggcttcgtgtcaaggctgagaaagctgctgaggagaagctgggttctcagatagatatt
ttggccccaatcaaatattga

DBGET integrated database retrieval system