KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334247
Entry
4334247           CDS       T01015                                 
Name
(RefSeq) 30S ribosomal protein S9, chloroplastic
  KO
K02996  small subunit ribosomal protein S9
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4334247
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4334247
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    4334247
  Bacteria
    4334247
  Archaea
    4334247
SSDB
Motif
Pfam: Ribosomal_S9
Other DBs
NCBI-GeneID: 4334247
NCBI-ProteinID: XP_015628866
UniProt: Q6AU40 Q9XJ28
LinkDB
Position
3:complement(31845463..31847238)
AA seq 223 aa
MALSLTTAFSHLSLPSTSKFHPLPLLHLRFPSSSSSRRAARLALAASAAEAAEPVEVEEA
PAEDGADEVVAVEDELSGPALRKYVKQRLPGGFAAQRITATGRRKTAIARVVLQEGTGRV
FINFRDAKEYLQGNPMWMEYCKVPLVTLGFENSYDVFVKVHGGGLSGQAQAICLGVARAL
VKISTANKVTLRGEGLLTRDTRIVERKKAGLKKARKRPQFSKR
NT seq 672 nt   +upstreamnt  +downstreamnt
atggcgctctccctcaccaccgccttctcccacctctccctcccctccacctccaagttc
cacccgctccccctcctccacctccgcttcccctcctcctcctcctcccgccgcgccgcg
cgcctcgcgctcgccgcctccgccgccgaggccgccgagcctgtcgaggtggaggaggcg
cccgccgaggacggggcggatgaggtggtggccgtggaggacgagctgtccggaccggcg
ctgcgaaagtacgtgaagcagcggcttcccgggggcttcgcggcgcagcggatcaccgcc
acgggccgccgcaagacggccatcgcccgcgtcgtgctccaggagggcaccggaagggtg
ttcatcaacttccgcgatgccaaggagtatttgcaaggaaatccaatgtggatggagtac
tgcaaggtacccctggtgaccctagggttcgagaacagctacgacgtcttcgtcaaagtt
cacgggggtggtctctcgggccaagcccaggccatttgcctcggcgtcgcccgtgcactg
gtgaagatcagcaccgcaaacaaagttactctgaggggagaaggtttgctgacaagagac
acccgtatagttgaaaggaagaaggctggtcttaagaaggcacgcaagcgcccgcagttc
tcaaagcgttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344162
Entry
4344162           CDS       T01015                                 
Name
(RefSeq) 37S ribosomal protein S9, mitochondrial
  KO
K02996  small subunit ribosomal protein S9
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4344162
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4344162
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    4344162
  Bacteria
    4344162
  Archaea
    4344162
SSDB
Motif
Pfam: Ribosomal_S9 Virul_Fac
Other DBs
NCBI-GeneID: 4344162
NCBI-ProteinID: XP_015646854
UniProt: A0A0P0XA73 Q7XAM9
LinkDB
Position
7:complement(27706384..27709959)
AA seq 415 aa
MLLRRLLHSSRRLGHRLQTLTPASAATAAAASSSPVSAPLPFRRPLPASSLLWPRLLSTS
GRDDDPNKPWAFTPESGDPDPFAAGEGVEAPAGEDPLGLSAAGEDPWAKDFRAEGSEKGD
VFEEIFKEEAATAAVASGEKAPGAGADELWTLSGEDEKDPFAEAVLGGGLEGIGGDGAAI
DEADAGEDEEEEERKRLERRAREQELMETLKGPNRAFGDLIEASGITEDMIASLILLKDV
RGVPGLPPLREIEDETIEKMNATSSRADVERQKQEEIAKARVRQVDEKGRAYGTGKRKCS
IARVWIQPGDGKFIVNDKQFDSYFPILDHRADLLRPFTVTKTLGRWDVTCTVKGGGVSGQ
VGAIRLGISRALQNWEPGLRPNLKAAGYLTRDSRVVERKKPGKAKARKSFQWVKR
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgctgctccgccgcctcctccactcctcccgccgcctcggccaccgcctccaaacccta
actccggcgagcgcagccaccgccgccgctgcctcgtcctctcccgtctccgctcccctt
ccatttcgtcgtcccctccccgcctccagcctcctctggccgcggctcctctccacgtcc
ggccgcgacgacgaccccaacaagccatgggcgttcacgccggaatccggcgatccggat
cccttcgccgccggtgagggcgtcgaagctcccgccggcgaggatccactaggattgagc
gccgccggcgaggacccgtgggcgaaggatttccgcgcggagggcagcgagaagggggac
gtgttcgaggagatcttcaaggaagaggctgccaccgccgccgtcgcttctggagagaag
gctccgggggcaggcgccgacgagctgtggacgctgagtggggaggatgagaaggatcct
ttcgcggaggccgtgctcgggggtgggcttgaggggatcggaggtgatggcgctgcgatt
gatgaggccgatgcgggggaagacgaggaggaggaagagcgaaaacggctagagagaagg
gcgagggagcaagaactaatggagacactcaaaggtccaaatcgtgcatttggtgatctc
attgaggcctctgggattacagaggatatgattgctagtttgatcctcttaaaggatgtt
aggggtgttcctggattacctcccctaagagaaatagaagatgaaactatcgaaaaaatg
aatgcaacatcaagcagagctgatgtagaacgccaaaagcaagaggaaattgctaaagca
cgtgtaagacaagtcgatgagaaaggaagggcttatggaacagggaaaaggaaatgcagc
attgcccgtgtttggattcagcctggtgatgggaagttcattgtcaatgacaaacaattt
gattcttacttcccaattctggatcatcgggctgatcttcttcgcccatttaccgtgacc
aaaactttggggcgttgggatgttacttgtactgtgaaaggtggtggtgtctcaggacaa
gttggagctatccggctagggatcagcagggccttgcagaattgggaaccaggactacgc
ccaaatctcaaagcagctggatatttgacaagagactcacgggttgttgaaaggaaaaag
cctggaaaggcaaaagcaagaaagagcttccaatgggtcaaacggtaa

DBGET integrated database retrieval system