KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334290
Entry
4334290           CDS       T01015                                 
Name
(RefSeq) glucose-6-phosphate isomerase, cytosolic A
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00030  Pentose phosphate pathway
osa00500  Starch and sucrose metabolism
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01250  Biosynthesis of nucleotide sugars
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
osa_M00892  UDP-N-acetyl-D-glucosamine biosynthesis, eukaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4334290
   00030 Pentose phosphate pathway
    4334290
   00500 Starch and sucrose metabolism
    4334290
   00520 Amino sugar and nucleotide sugar metabolism
    4334290
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4334290
Enzymes [BR:osa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     4334290
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4334290
  Exosomal proteins of other body fluids (saliva and urine)
   4334290
  Exosomal proteins of colorectal cancer cells
   4334290
SSDB
Motif
Pfam: PGI DUF2586
Other DBs
NCBI-GeneID: 4334290
NCBI-ProteinID: XP_015632584
UniProt: P42862
LinkDB
Position
3:32175128..32182077
AA seq 567 aa
MASSALICDTEQWKGLQAHVGEIQKTHLRHLMHDVERCKAMTAEYEGIYLDYSRQRATGE
TMEKLFKLAEAAKLKEKIEKMFRGDKINSTENRSVLHVALRAPRDEVINSNGVNVVPEVW
GVKDKIKQFSETFRSGSWVGATGKALTNVVSVGIGGSFLGPLFVHAALQTDPEAAESAKG
RQLRFLANVDPVDVARSIKDLDPETTLVVVVSKTFTTAETMLNARTLKEWIVSSLGPDAV
AKHMIAVSTNLELVEKFGIDPKNAFAFWDWVGGRYSVCSAVGVLPLSLQYGFPIVQKFLE
GAASIDKHFRSSSFEKNIPVLLGLLSVWNVSFLGYPARAILPYSQALEKFAPHIQQLSME
SNGKGVSIDGVQLPFESGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLK
GEIVSNHDELMSNFFAQPDALAYGKTPEQLHSEKVPEHLIPHKTFQGNRPSLSLLLPSLS
AYEIGQLLAIYEHRIAVQGFLWGINSFDQWGVELGKSLASQVRKSLHASRVEGKPVLGFN
SSTTSLLTRYLAVEPSTPYNTTTLPKV
NT seq 1704 nt   +upstreamnt  +downstreamnt
atggcgtcgtcggcgctcatctgcgacaccgagcagtggaagggcctccaggcgcatgtt
ggggagattcagaaaacgcacctgcgccatctgatgcatgatgttgagcgctgcaaggca
atgacagctgagtatgaaggcatatatctggattactcgaggcagcgtgcgactggcgaa
accatggagaagctgtttaaattggccgaggctgcaaagctcaaggagaagattgagaag
atgtttagaggtgacaagataaatagcacagagaacagatcagtgcttcatgtagctcta
agggctccaagagacgaagtaataaatagcaatggggtcaatgtggttcccgaagtttgg
ggtgtaaaagataaaatcaagcaattttcagaaacttttaggagtggatcatgggttggg
gcaactggtaaagcattgacaaatgttgtgtcagtaggaataggtggtagctttcttggt
cctctgtttgtgcatgctgccctccagacagatccagaagctgcagaatctgccaaaggg
cggcaattaagatttcttgcaaatgtcgaccctgttgatgttgcacgaagcatcaaagat
ttagatcctgaaacaacacttgttgtggtagtctcgaagaccttcacaacagctgaaaca
atgttaaatgctcgaactcttaaggagtggattgtctcttctcttggacctgatgctgtt
gcaaaacatatgattgctgtcagtaccaatcttgagcttgtggagaagtttggaattgac
ccgaaaaatgcttttgcattttgggactgggttggtggccgctatagtgtttgcagtgct
gttggtgtcctgcccttatctcttcagtatggctttccgattgttcagaaatttttggag
ggtgcagccagcatcgacaaacactttcgttcatcttcatttgagaaaaatattcctgta
ctccttggtttgctgagtgtgtggaatgtttcatttctcggatatccagctagagcaata
ctgccctattcccaagcacttgagaaatttgcaccgcatattcagcagcttagcatggag
agtaatggaaagggtgtctccattgatggtgttcaactgccctttgagagtggtgaaatt
gattttggtgaacctggaaccaatgggcaacacagcttctatcaattaatccatcaggga
agagttattccttgtgattttatcggtgtcgtaaaaagccagcaacctgtttacttgaaa
ggggaaattgtgagcaatcatgacgaattgatgtccaatttctttgctcagcctgatgcg
cttgcttatggaaagactcctgaacaactgcatagcgagaaagtacctgaacatcttatc
cctcataagacttttcagggcaaccgaccatcgcttagtttattgctgccctcattatct
gcttatgagattggacagcttttagccatctacgagcaccggattgcagtccagggtttc
ctatggggaataaactcatttgaccagtggggagtggaactgggcaagtctcttgcctct
caagtgagaaaatctctacatgcatcccgcgttgaaggaaagcctgtcctggggtttaac
agcagtactacaagtttgctgacacgatatcttgctgttgagccatccactccttacaac
actaccacactgccgaaagtttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340677
Entry
4340677           CDS       T01015                                 
Name
(RefSeq) glucose-6-phosphate isomerase, cytosolic B
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00030  Pentose phosphate pathway
osa00500  Starch and sucrose metabolism
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01250  Biosynthesis of nucleotide sugars
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
osa_M00892  UDP-N-acetyl-D-glucosamine biosynthesis, eukaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4340677
   00030 Pentose phosphate pathway
    4340677
   00500 Starch and sucrose metabolism
    4340677
   00520 Amino sugar and nucleotide sugar metabolism
    4340677
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4340677
Enzymes [BR:osa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     4340677
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4340677
  Exosomal proteins of other body fluids (saliva and urine)
   4340677
  Exosomal proteins of colorectal cancer cells
   4340677
SSDB
Motif
Pfam: PGI
Other DBs
NCBI-GeneID: 4340677
NCBI-ProteinID: XP_015644261
UniProt: P42863 Q0DD43 B9FSL1
LinkDB
Position
6:8152235..8159385
AA seq 567 aa
MASSALICDTEQWKGLQAHVGAIQKTHLRDLMDDAERCKAMTAEYEGIFLDYSRQRATGE
TMEKLFKLAEAAKLKEKIEKMFSGDKINSTENRSVLHVALRAPRDEVIKSDGVNVVPEVW
GVKDKIKQFSETFRSGSWVGATGKALTNVVSVGIGGSFLGPLFVHAALQTDPEAAESAKG
RQLRFLANVDPVDVARSIKDLDPETTLVVVVSKTFTTAETMLNARTLKEWIVSSLGPDAV
AKHMIAVSTNLELVEKFGIDPKNAFAFWDWVGGRYSVCSAVGVLPLSLQYGFPIVQKFLE
GAASIDKHFRSSSFEKNIPVLLGLLSVWNVSFLGYPARAILPYSQALEKFAPHIQQLSME
SNGKGVSIDGVQLSFETGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKSQQPVYLK
GEIVSNHDELMSNFFAQPDALAYGKTPEQLHSEKVPEHLISHKTFQGNRPSLSLLLPSLS
AYEIGQLLSIYEHRIAVQGFLWGINSFDQWGVELGKSLASQVRKSLHASRMEGKPVQGFN
SSTASLLTRYLAVEPSTPYNTTTMPKV
NT seq 1704 nt   +upstreamnt  +downstreamnt
atggcgtcgtcggcgctaatctgcgacaccgagcagtggaagggcctccaggcgcacgtc
ggggcgattcagaagacgcacctgcgcgatctgatggatgatgccgagcgctgcaaggca
atgacagctgagtatgaaggcatatttctggattactcgaggcagcgtgcaactggcgag
accatggagaagctgtttaaattggcagaggcggcaaagctcaaggagaagattgagaag
atgtttagtggtgacaagataaatagcacagagaacagatctgtgcttcatgtagctcta
agggctccaagagacgaagtaataaaaagtgatggggtcaatgtggttcccgaagtttgg
ggtgtaaaagataaaatcaagcagttttcagaaacttttaggagtggatcatgggttggg
gcaactggtaaagcattgacaaatgttgtgtcagttggaataggtggtagctttcttggt
cctctgttcgtgcatgctgccctccagacagatccagaagctgcagaatctgccaaaggg
cgacagttaagattccttgcaaatgttgaccctgttgatgttgcacgaagcatcaaagat
ttagatcctgaaacaacacttgttgtggttgtctcaaagaccttcacaacagctgaaaca
atgttaaatgctcgaactctcaaggagtggattgtctcttctcttggacctgatgctgtt
gcgaaacatatgattgctgtcagtaccaatcttgagcttgtggagaagtttggaattgac
cctaaaaatgcttttgcattttgggactgggttggtggtcgctatagtgtttgcagtgct
gttggtgtcctgcccttatctcttcaatatggttttccgattgttcagaaatttttggag
ggtgcagccagcatcgacaaacacttccgttcatcttcatttgagaaaaacatacctgta
ctccttggtttgctgagtgtgtggaatgtttcctttcttggatatccagctagagcaata
ttgccctattcccaggcacttgagaaatttgcaccacatattcagcagcttagcatggag
agtaatggaaagggtgtctctattgatggcgttcaattgtcctttgagactggtgaaatt
gattttggtgaacctggaaccaatgggcaacacagcttctatcaattaatccatcaggga
agagttattccttgtgattttatcggcgtcgtgaaaagccagcaacccgtttacttgaaa
ggggaaattgtgagcaatcatgacgaattgatgtccaatttctttgctcagcctgatgca
cttgcttatggaaagacccctgaacaactgcacagcgagaaagtacctgaacatcttatc
tctcataagacttttcagggcaaccgaccatcacttagtttattgctgccctcattatct
gcttatgagattggacagcttttatccatctacgagcaccggattgcagttcagggtttc
ctatggggaataaactcatttgaccagtggggagtggaactgggaaagtctctggcttct
caagtgagaaaatctctgcatgcatcccgcatggaaggaaagcctgtccaggggttcaac
agcagcactgcaagtttgctgacacgatatctcgctgttgagccatccactccttacaac
actacaacaatgccgaaagtttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345842
Entry
4345842           CDS       T01015                                 
Name
(RefSeq) glucose-6-phosphate isomerase 1, chloroplastic
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00030  Pentose phosphate pathway
osa00500  Starch and sucrose metabolism
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01250  Biosynthesis of nucleotide sugars
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
osa_M00892  UDP-N-acetyl-D-glucosamine biosynthesis, eukaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4345842
   00030 Pentose phosphate pathway
    4345842
   00500 Starch and sucrose metabolism
    4345842
   00520 Amino sugar and nucleotide sugar metabolism
    4345842
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4345842
Enzymes [BR:osa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     4345842
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4345842
  Exosomal proteins of other body fluids (saliva and urine)
   4345842
  Exosomal proteins of colorectal cancer cells
   4345842
SSDB
Motif
Pfam: PGI
Other DBs
NCBI-GeneID: 4345842
NCBI-ProteinID: XP_015648265
UniProt: Q0J4Z8 Q6ZB94
LinkDB
Position
8:complement(23623121..23628613)
AA seq 615 aa
MASISGAAAAAPSSSGASCGLRLRRDHLPRSSHFRLARPSSITDVSRSCSSSSSSPPRSL
SSKQSGHADVLAHGAVDKDPIRLWNRYVEWLYQHKQLGLFVDVSRIGFTEEFLRRMEAPM
GRAFAAMRELEKGAIANPDEGRMVGHYWLRNPALAPNSFLRDKIETTLERILAFASDVIS
AKIRPPSSPAGRFTQILSIGIGGSSLGPQFVAEALAPDNPPLMIRFIDNTDPAGIDHQIA
QLGPELASTLVIVISKSGGTPETRNGLLEVQKAFRDAGLEFSKQGVAITQENSLLDNTAR
IEGWLARFPMFDWVGGRTSEMSAVGLLPAALQGIDIKEMLVGAAQMDEETRNTEIKENPA
ALLALCWYWASDGIGSKDSLLLLSRYLQQLVMESLGKEFDLDGNRVNQGLTVYGNKGSTD
QHAYIQQLREGVHNFFVTFIEVLRDRPPGHEWELEPSVTCGDYLFGMLHGTRSALYANDR
ESITVTVQEVNPRAVGALVALYERAVGLYAYLININAYHQPGVEAGKKAAGEVLALQKRI
LLVLNEASCKDPAEPLTLDQIADRCHCPEEIEMIYKIIQHMAANDRALIAEGNCGSPRSI
KVYLGECNVDDDMNS
NT seq 1848 nt   +upstreamnt  +downstreamnt
atggcttccatctccggcgcggcggcggcggcgccctcctcctccggggcgtcgtgcggc
ctccgcctccggcgagaccacctcccgcgctcctcccacttccgcctcgcccgtcccagc
tccatcaccgacgtctcccgctcctgctcgtcgtcgtcatcctctcctccccgctcgctc
agctccaagcagtcgggccacgccgacgtcctcgcccatggcgcggtggacaaggacccc
atcaggctgtggaaccgctacgtggagtggctgtaccagcacaagcagctggggctgttc
gtcgacgtgagccggatcgggttcaccgaggagttcctgcggcggatggaggcgcccatg
gggcgggcgttcgcggcgatgcgggagctcgagaagggcgccatcgccaaccccgacgag
ggccggatggtcggccactactggctgcgcaacccggccctcgcccccaactccttcctc
cgcgacaaaatcgagaccacgctcgaacgcatcctcgcgttcgccagcgacgtcatctcc
gccaagataagacctccatcctcccctgctggccgatttactcaaatactttctatagga
attggtggttcatctttggggccacaatttgttgcggaggcacttgctccagataaccct
cctctgatgataagatttatcgacaacaccgatccagctggaattgaccatcagattgca
cagctaggaccagaacttgcatcaactcttgtgattgtaatatcaaagagtggaggcaca
cctgaaacacgaaatggtctattagaagtacaaaaggccttccgagatgctggactagaa
ttctcgaaacagggtgttgcaattactcaagagaattctttattagataacactgccaga
atagaggggtggttagctagatttcccatgtttgactgggttggtggtagaacatcagaa
atgtcagctgttggtttactgccagcagcattacagggtattgacatcaaggaaatgcta
gttggtgctgcacaaatggatgaggaaactaggaatactgagattaaggaaaatccagca
gccttgcttgcattgtgttggtattgggcatcggatggaataggcagtaaggatagcctg
cttcttttgagtagatacttgcaacaacttgtcatggaatctcttggaaaagaatttgac
cttgatggaaatcgggttaatcagggactaactgtttatggtaacaaaggaagcacagac
cagcatgcctacattcagcagctgagagaaggtgtgcacaacttctttgttacttttatt
gaagttttgcgcgataggcctcctggtcatgagtgggagcttgaaccaagtgttacatgt
ggggactacttgtttggaatgctacatggaactcgttcagctctttatgcaaatgaccgc
gaatctattacagtcactgtccaagaagtaaaccctagagctgttggagcacttgttgca
ctctatgagcgtgctgtcggtctttatgcttatttaatcaacatcaatgcctatcatcaa
cctggtgtcgaagcagggaaaaaggctgctggagaggtgttggcacttcagaaaaggatc
ctacttgttcttaacgaagccagctgcaaggaccctgctgagccattgacactggatcaa
attgcagatcgctgccactgtcctgaagagatcgaaatgatatacaaaataatccaacac
atggctgcaaacgatagagctcttattgcagaaggcaactgcgggtcaccaagaagcatc
aaggtctaccttggagaatgcaacgtggatgatgatatgaattcttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347311
Entry
4347311           CDS       T01015                                 
Name
(RefSeq) glucose-6-phosphate isomerase 1, chloroplastic
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00030  Pentose phosphate pathway
osa00500  Starch and sucrose metabolism
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01250  Biosynthesis of nucleotide sugars
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
osa_M00892  UDP-N-acetyl-D-glucosamine biosynthesis, eukaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4347311
   00030 Pentose phosphate pathway
    4347311
   00500 Starch and sucrose metabolism
    4347311
   00520 Amino sugar and nucleotide sugar metabolism
    4347311
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4347311
Enzymes [BR:osa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     4347311
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4347311
  Exosomal proteins of other body fluids (saliva and urine)
   4347311
  Exosomal proteins of colorectal cancer cells
   4347311
SSDB
Motif
Pfam: PGI
Other DBs
NCBI-GeneID: 4347311
NCBI-ProteinID: XP_015611795
UniProt: Q0J136
LinkDB
Position
9:complement(17648533..17653624)
AA seq 625 aa
MASISGAAAPPSSSAACRLRLRRQLLLRPSHLRLRAPHSIADLSRSSSSSSEQQPSSTPA
APLASRPGQNGSTRGAVEKDPIKLWERYVEWLYQHKELGLFVDVSRMGFTEEFLRRMEPR
MQRAFAAMRELEKGAIANPDEGRMVGHYWLRDPGLAPNSFLRTKIETTLDRILAFSQDVV
SGKIKPPSSPAGRFTQILSIGIGGSALGPQFVSEALAPDNPPLKIRFIDNTDPAGIDHQI
AQLGPELASTLVIVISKSGGTPETRNGLLEVQKAFRDAGLDFSKQGVAVTQENSLLDNTA
RIEGWLARFPMFDWVGGRTSEMSAVGLLPAALQGIDIKEMLVGAALMDEETRNTVVKENP
AALLALCWYWASEGIGNKDMVVLPYKDSLLLLSRYLQQLVMESLGKEFDLDGNRVNQGLT
VYGNKGSTDQHAYIQQLREGVHNFFVTFIEVLRDRPPGHDWELEPGVTCGDYLFGMLQGT
RSALYSNDRESISVTVQEVTPRAVGALVALYERAVGIYASLVNINAYHQPGVEAGKKAAG
EVLALQKRVLTVLNEASCKDPAEPLTLDQIAERCHCPEDIEMIYKIIQHMAANDRALIAE
GSCGSPRSIKVYLGECNVDEDMLAA
NT seq 1878 nt   +upstreamnt  +downstreamnt
atggcgtccatctccggcgcggcggcgcctccgtcctcgtcggcggcgtgcaggctgcgg
ctgcggcggcagctcctcctccgcccctcccacctccgcctccgcgccccccactccatc
gcggacctctcccgctcctcctcgtcctcgtcggagcagcagccctcctctaccccggcg
gcgccgctcgcctccaggccggggcagaacggcagcacccgcggcgcggtggagaaggac
ccgatcaagctgtgggagaggtacgtggagtggctgtaccagcacaaggagctcggcctg
ttcgtggacgtgagccggatggggttcacggaggagttcctccgccggatggagccgcgg
atgcagcgcgccttcgcggcgatgcgggagctcgagaagggggccatcgccaaccccgac
gagggccgcatggttggccattactggctccgcgacccaggcctcgcccccaactccttc
ctccgcaccaagatcgagaccaccctcgaccgcatcctcgccttctcccaagacgtcgtc
tccggcaagattaaacctccgtcatctccagctggccgatttactcaaatactctcaata
ggaattggaggatcagctttggggcctcaatttgtttcagaggcacttgcacctgataac
cctccattgaagatacgatttattgacaacactgatcctgctggaatcgaccatcaaatt
gctcaactaggaccagagcttgcatctactcttgtaattgttatttctaagagtggaggc
acacctgaaacccggaatggtctgcttgaagtgcaaaaagccttccgagatgctgggctg
gatttctcgaaacagggagttgcagttactcaagaaaattctctgttagacaacactgcc
agaatagagggatggttagctagatttcccatgtttgactgggttggtggaagaacatca
gaaatgtcagctgtcggattgcttccagctgcattacagggtatcgatatcaaagaaatg
ttagttggcgcagcactaatggatgaggaaaccaggaatactgtggttaaggaaaatcca
gcagccttacttgctttgtgctggtattgggcatcggaaggaataggaaataaggatatg
gttgtacttccgtacaaggatagtttgctacttttgagtagatatttgcaacagcttgtc
atggaatctcttgggaaagaatttgaccttgatggcaatcgggttaatcaaggtctaact
gtgtatggcaacaaaggaagcaccgatcagcatgcctacattcagcagctgagagaaggt
gtacacaacttcttcgttacttttattgaggttttgcgtgataggcctcctggtcatgat
tgggagcttgaacctggagttacatgtggtgactatttgttcgggatgttgcagggaacc
cgttctgctctttattctaatgaccgagaatccatctccgttactgtgcaagaagttact
cctagggctgttggagcgctggttgctctatatgaacgtgctgtggggatttatgcttct
ttagtaaatatcaatgcctatcatcagcctggtgttgaggctgggaaaaaggcagcaggt
gaagtgttggcacttcagaagagggtgctgactgttctgaatgaggccagctgcaaggat
cctgccgagccgttgacgctggatcaaatagcagagcgctgtcattgccctgaagatatt
gagatgatatacaaaataatccagcacatggcagcaaatgatagagcgctcatagcagaa
ggcagctgcggttctcctcgaagcatcaaggtttaccttggagaatgcaatgtagatgag
gatatgcttgctgcttag

DBGET integrated database retrieval system