KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334316
Entry
4334316           CDS       T01015                                 
Name
(RefSeq) probable ribose-5-phosphate isomerase 4, chloroplastic
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00030  Pentose phosphate pathway
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
osa_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
osa_M00165  Reductive pentose phosphate cycle (Calvin cycle)
osa_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
osa_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    4334316
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4334316
Enzymes [BR:osa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     4334316
SSDB
Motif
Pfam: Rib_5-P_isom_A
Other DBs
NCBI-GeneID: 4334316
NCBI-ProteinID: XP_015632189
UniProt: Q10CS9 A0A8J8YD96
LinkDB
Position
3:complement(32394975..32397257)
AA seq 299 aa
MDAVAGASVSSSSARLRPCPRPRRIGNVAPATVRRRSRRRAVTCAAAADADVVGLFDAAK
LTVDRFVESGMVVGLGSGPASGLAIQYLGTRLRRGSLTGILGIPSSTISASEAVKAGIQV
SSYEEGTQIDFAFTDADIIEEDTMTAVIGRRKTESGEPSFMVEKGIVKSADKLAFIIGHE
KYVKGIEGSIPVLVKSANWIDTAEEIDDLFLGDAEVWRRPSIGTAGPLGGDFPLVTKEGH
HVLDVIFTTPIPDLGKVAESLEKIAGVVDHGIVSSIPSYVVVALNGEVQVLDEKSSVIP
NT seq 900 nt   +upstreamnt  +downstreamnt
atggacgccgttgccggggcaagcgtgagctcctcttcggcgcggctccgcccgtgccca
cgcccccgccgcatcggcaacgtcgcaccggccaccgtgcgccgccgtagccggagacgt
gctgtgacctgcgcggccgccgcggacgccgacgtcgtcggcctcttcgacgccgccaag
ctcacggtggacaggtttgtggagagcggcatggtggtcgggctcggctccggcccggcg
tccggcctcgccatccagtacctcggcactcgcctccggcgagggtctctcactggcatc
cttggaataccctcgtccacgatcagtgcaagtgaggcagtgaaagcagggatacaggtc
agcagctacgaggaaggcacccaaattgactttgctttcactgatgctgatataattgaa
gaggacacaatgaccgctgtcattggccgtcggaaaacggagagcggagagccttctttc
atggtggagaagggtattgttaaatcagctgataaacttgccttcatcattggccatgaa
aaatatgtgaaaggcatcgaaggttcaattccagtcttggtgaaaagtgcaaattggatc
gacactgctgaagagattgatgacttgttcctaggagacgcagaggtatggaggcggcca
tcgattggaaccgctggtccattaggaggtgacttcccattggttaccaaggagggccat
catgtacttgatgttatcttcacaactcccatcccggatcttggtaaggtagcagaaagc
ttggagaaaattgccggtgtcgtggaccatgggatagtttccagcattccatcatatgtc
gtagttgcattgaacggggaagtgcaggtcttggatgagaagtcatcggtgataccatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335430
Entry
4335430           CDS       T01015                                 
Name
(RefSeq) probable ribose-5-phosphate isomerase 1
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00030  Pentose phosphate pathway
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
osa_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
osa_M00165  Reductive pentose phosphate cycle (Calvin cycle)
osa_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
osa_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    4335430
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4335430
Enzymes [BR:osa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     4335430
SSDB
Motif
Pfam: Rib_5-P_isom_A DeoRC Sugar-bind
Other DBs
NCBI-GeneID: 4335430
NCBI-ProteinID: XP_015633390
UniProt: A3AS68 Q7XVP0
LinkDB
Position
4:13802282..13803484
AA seq 275 aa
MGSFASPLDAAPAPPTAKPSPPPAPAPANGLVTQEELKRVAAHRAVEMVEPGMTLGLGTG
STAAHALDRLGDLLRSGELAAVAGVPTSLKTEAHAARVGIPMLPLGEAGGIDLSIDGADE
VDPELNLVKGRGGSLLREKMIEGSGGRFVVIVDESKLVPRLGCTGAVPVEVVPFGCDHTL
GLVRKVFDGLPGFSARLRTVASKDGEGKEEMFVTDNGNYIVEMFFEDGIRGDLNEISDRL
LRITGVVEHGMFLGMATSVVVAKKDGTVALLHKKK
NT seq 828 nt   +upstreamnt  +downstreamnt
atgggcagcttcgcctcccccctcgacgccgcccccgcccctcccaccgccaagccctcc
cctccgccggcgccggcgccggccaacgggctggtgacccaggaggagctgaagcgggtg
gcggcgcaccgggccgtggagatggtggagcccgggatgacgctgggcctcggcacgggc
tccaccgcggcccacgcgctggaccgcctcggcgacctcctccggtccggggagctcgcc
gcggtggccggcgtcccgacctcgctcaagacggaggcgcacgccgccagggtggggatc
ccgatgctgccgctcggggaggcgggcgggatcgatctgtccatcgacggcgccgacgag
gtcgacccggagctgaacctcgtgaaggggcggggtgggtcgctgctcagggagaagatg
atcgaggggtccgggggaaggttcgtcgtcatcgtcgatgagtccaagctcgtcccgcgg
ctcggctgtacgggcgccgtccccgtcgaggttgtccccttcgggtgcgaccacactctg
ggcctcgtccgcaaggtgttcgacggattgcctggcttcagcgcgaggctcaggacggtc
gcctccaaggacggcgaggggaaggaggagatgttcgtcaccgacaacggcaactacatc
gtcgagatgttcttcgaggatggcatacgcggcgacctcaacgagatcagcgaccgcctc
ctacggatcaccggcgtcgtcgagcacggcatgttcctcggcatggccacctcggtggtc
gtcgccaagaaggacggcaccgtcgccctgctccacaagaagaagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342543
Entry
4342543           CDS       T01015                                 
Name
(RefSeq) probable ribose-5-phosphate isomerase 3, chloroplastic
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00030  Pentose phosphate pathway
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
osa_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
osa_M00165  Reductive pentose phosphate cycle (Calvin cycle)
osa_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
osa_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    4342543
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4342543
Enzymes [BR:osa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     4342543
SSDB
Motif
Pfam: Rib_5-P_isom_A DeoRC
Other DBs
NCBI-GeneID: 4342543
NCBI-ProteinID: XP_015647995
UniProt: A3BH42 Q6ZEZ2
LinkDB
Position
7:complement(4068002..4070232)
AA seq 280 aa
MAAATVSVRFHPAASAARCGGGSRRSRRLSGVIRAQSAPASAAAAALTQDDLKRLAAVRA
VEQVESGMVLGLGTGSTAAFAVAEIGALLASGKLSGIVGVPTSKRTFEQAQSLGIPLSTL
DDHPRIDLAIDGADEVDPDLNLVKGRGGALLREKMVEAASDKFIVVVDETKLVTGLGGSG
LAMPVEVVQFCWKYNQVRLQDLFNDEGCEAKLRLDEGGKPYVTDNSNYIVDLYFKTPIKD
ALAAGKEISALEGVVEHGLFLDMATSVIIAGTDGVSVKTK
NT seq 843 nt   +upstreamnt  +downstreamnt
atggccgccgccaccgtctccgtccgcttccacccggccgcatccgccgcgcgctgcggc
ggcggctcgcgccggagcaggcgcctgtccggggtcatcagggcgcagtcggcgccggct
tcggcggcggcggcggcgctgacgcaggacgacctgaagaggctggcggcggtgcgcgcg
gtggagcaggtggagagcgggatggtgctggggctggggaccgggtcgacggcggccttc
gccgtcgcggagatcggggcgctgctggcgtccgggaagctgagcggcatcgtcggggtg
cccacctccaagcgcacgttcgagcaggcgcagtcgctcggcatcccgctctccaccctc
gacgaccacccccgcatcgacctcgccatcgacggcgccgacgaggtcgatccagacctt
aaccttgtgaaagggagaggtggtgcccttctccgggagaagatggttgaggcagcatca
gacaagttcatcgttgttgttgacgagacaaagctagttaccggcttaggagggagtggt
ctagccatgcctgtggaggttgtgcagttctgctggaagtacaaccaagtgagattgcag
gatctgtttaacgatgaaggatgcgaggcgaagctgagattggatgaaggcggcaaaccc
tacgttaccgacaactcaaactacatcgttgatttatacttcaagacgccgatcaaggat
gcgttggcagcagggaaggagatctcagctttggaaggcgtcgttgagcatgggctgttc
ctggacatggcgacttcggtgatcatcgctggaacagatggcgtcagtgtcaaaacaaag
tga

DBGET integrated database retrieval system