KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334386
Entry
4334386           CDS       T01015                                 
Name
(RefSeq) ubiquitin-conjugating enzyme E2 2
  KO
K10573  ubiquitin-conjugating enzyme E2 A [EC:2.3.2.23]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4334386
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4334386
   03400 DNA repair and recombination proteins [BR:osa03400]
    4334386
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     4334386
Ubiquitin system [BR:osa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   4334386
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Rad6 epistasis group
    4334386
SSDB
Motif
Pfam: UQ_con RWD Prok-E2_B
Other DBs
NCBI-GeneID: 4334386
NCBI-ProteinID: XP_015631390
UniProt: A3ANH8 Q8SBC1
LinkDB
Position
3:complement(32930286..32935491)
AA seq 152 aa
MSTPARKRLMRDFKRLQQDPPAGISGAPHDNNIMLWNAVIFGPDDTPWDGGTFKLTLQFT
EDYPNKPPVVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNS
PANSEAARLFSENKREYNRKVREIVEQSWTAD
NT seq 459 nt   +upstreamnt  +downstreamnt
atgtcgacgccggcgaggaagcggctgatgcgggacttcaagcggctgcagcaggacccg
cccgccggaatcagcggcgcgccgcacgacaacaacatcatgctctggaacgccgtcata
ttcggaccggatgacacgccgtgggatggaggcacgttcaagctgacactacaatttaca
gaagattatcccaacaaaccaccagttgttcggtttgtctcaaggatgtttcacccaaat
atttatgcagatggaagtatctgcttggatatcctacaaaatcaatggagccctatatat
gatgttgctgcgatattgacctctatccagtccctgctctgtgatccaaacccaaactcc
cctgcaaactccgaagcagccagactgttcagcgagaacaagcgcgagtacaaccgcaaa
gtccgcgagattgtggagcagagctggacggccgactaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337993
Entry
4337993           CDS       T01015                                 
Name
(RefSeq) ubiquitin-conjugating enzyme E2 2
  KO
K10573  ubiquitin-conjugating enzyme E2 A [EC:2.3.2.23]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4337993
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4337993
   03400 DNA repair and recombination proteins [BR:osa03400]
    4337993
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     4337993
Ubiquitin system [BR:osa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   4337993
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Rad6 epistasis group
    4337993
SSDB
Motif
Pfam: UQ_con RWD Prok-E2_B
Other DBs
NCBI-GeneID: 4337993
NCBI-ProteinID: XP_015640111
UniProt: B9FMU1 Q0DK90
LinkDB
Position
5:4958264..4964923
AA seq 152 aa
MSTPARKRLMRDFKRLMQDPPAGISGAPQDNNIMLWNAVIFGPDDTPWDGGTFKLTLQFT
EDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNS
PANSEAARLFSENKREYNRKVREIVEQSWTAD
NT seq 459 nt   +upstreamnt  +downstreamnt
atgtcgacgccagcaaggaagaggttgatgagggatttcaaacgactgatgcaggatcct
ccagctggcataagtggggccccacaggacaacaatataatgctttggaatgctgtaatt
tttggccctgatgatactccttgggatggaggtacgttcaagctgacacttcagtttact
gaagattatcctaacaagccacctacagtgcgatttgtttctcggatgtttcatcctaac
atttatgctgatgggagcatatgcttagatatactacaaaaccagtggagccccatatat
gatgtagctgctatactcacatccatccagtcgctgctttgcgatccaaacccaaattca
cctgccaactctgaagctgcccgcctattcagtgagaacaagcgggaatacaaccgaaaa
gttcgtgagatagtggagcagagctggaccgcggactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342488
Entry
4342488           CDS       T01015                                 
Name
(RefSeq) ubiquitin-conjugating enzyme E2 2
  KO
K10573  ubiquitin-conjugating enzyme E2 A [EC:2.3.2.23]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4342488
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4342488
   03400 DNA repair and recombination proteins [BR:osa03400]
    4342488
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     4342488
Ubiquitin system [BR:osa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   4342488
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Rad6 epistasis group
    4342488
SSDB
Motif
Pfam: UQ_con RWD Prok-E2_B
Other DBs
NCBI-GeneID: 4342488
NCBI-ProteinID: XP_015646642
UniProt: B9FVP1 Q7XIC8
LinkDB
Position
7:complement(3589311..3593888)
AA seq 152 aa
MSTPARKRLMRDFKRLQQDPPAGISGAPHDNNIMLWNAVIFGPDDTPWDGGTFKLTLQFT
EDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNS
PANSEAARLFSENKREYNRKVREIVEQSWTAD
NT seq 459 nt   +upstreamnt  +downstreamnt
atgtcgacgccggcgaggaagcggctgatgcgggacttcaagcggctgcagcaggacccc
cccgcggggatcagcggcgcgccgcacgacaacaacatcatgctctggaacgccgtcatc
ttcgggccggatgatacgccgtgggacggaggcacgttcaagcttaccttgcagtttaca
gaagattatcccaacaagccgccgactgttcggtttgtttctaggatgttccacccaaat
atttatgcagatggaagcatctgcttggatattctacagaaccagtggagccctatatat
gatgttgctgccatattgacttcaattcagtctttgctgtgtgatccaaaccccaactct
ccagcaaactcagaagctgccagactgtttagtgagaacaagcgagagtacaaccgcaag
gttcgtgagatcgtggagcagagctggacagctgactag

DBGET integrated database retrieval system