KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334425
Entry
4334425           CDS       T01015                                 
Name
(RefSeq) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00260  Glycine, serine and threonine metabolism
osa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4334425
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    4334425
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     4334425
SSDB
Motif
Pfam: Trp_syntA His_biosynth FMN_dh ThiG PcrB BtpA IGPS NanE TMP-TENI Ribul_P_3_epim
Other DBs
NCBI-GeneID: 4334425
NCBI-ProteinID: XP_015628215
UniProt: A3ANM3 Q7Y1H9
LinkDB
Position
3:complement(33193735..33198115)
AA seq 279 aa
MEMEDSGRGVVGAGKRGVAETFSRLREQGKTAFIPFITASDPDLATTSKALKILDSCGSD
VIELGVPYSDPLADGPVIQAAATRALKKGATFDSVIAMLKGVIPELSCPIVIFTYYNPIL
KRGVSNFMAIIKQAGVHGLVVPDLPLEETALLRNEAVMHGIELVLLTTPTTPTERMKEIA
KASEGFIYLVSSVGVTGARSNVNLRVEYLLQEIKKVTDKPVAVGFGISTPEHVKQIAGWG
ADGVIIGSAIVRQLGEAASPEEGLKRVEEYAKNMKAAMP
NT seq 840 nt   +upstreamnt  +downstreamnt
atggagatggaagatagcggtcgcggcgtcgtgggcgccgggaagcgcggcgtcgcggag
accttctccaggctccgggagcagggcaagactgcattcattccattcatcaccgccagt
gaccctgacttggcaaccacatcgaaagcgttgaagatccttgattcctgtggttcagat
gtgattgagctgggtgtaccttactcggatccgttggctgatgggccggttattcaggct
gcagcaacgcgtgctcttaagaaaggcgctacatttgattccgtcatagctatgctcaag
ggggttatacctgagttgtcttgtccaatagttatcttcacatactacaacccaatttta
aagcgcggagtgagtaacttcatggctatcattaaacaagccggcgtacatggtcttgta
gtacctgatcttcctttggaagagacagcgctgttgaggaatgaggctgtcatgcatggc
atagagctggtgctgcttacaacaccaaccacaccaacagagaggatgaaggagattgca
aaagcttcagaaggatttatttatcttgtaagttctgttggagttacaggtgcacgctca
aatgtaaatttgcgtgttgagtaccttcttcaggagatcaagaaggttacagacaaacct
gttgctgttggctttggcatatcgactccagagcatgtaaagcagattgcaggctgggga
gcagatggtgtgatcatcggcagcgctattgttagacagttaggagaggctgcttcacct
gaagaagggttgaaaagagtagaagagtatgccaagaacatgaaggctgctatgccttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341584
Entry
4341584           CDS       T01015                                 
Name
(RefSeq) tryptophan synthase beta chain 2 isoform X1
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00260  Glycine, serine and threonine metabolism
osa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4341584
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    4341584
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     4341584
SSDB
Motif
Pfam: PALP
Other DBs
NCBI-GeneID: 4341584
NCBI-ProteinID: XP_015643991
UniProt: Q67VM1 A0A0P0WYX1
LinkDB
Position
6:complement(25590291..25594483)
AA seq 487 aa
MATTASVRPPLLRQAAGSEKASLLCKPKQRASVRRRSFTARASSNPVSIPKQWYNLVADL
PVKPPPPLHPQTHQPLNPSDLSPLFPDELIRQEVTEERFIDIPEEVAEVYKLWRPTPLIR
ARRLEKLLGTPAKIYYKYEGTSPAGSHKPNTAVPQAWYNAAAGVRSVVTETGAGQWGSAL
SFASSLFGLTCEVWQVRASYDQKPYRRLMMETWGATVHPSPSAATESGRRILERDPASPG
SLGIAISEAVEVAARDADTKYCLGSVLNHVLLHQTVIGEECLEQLAAAGDVPDVVIGCTG
GGSNFGGLVFPFMREKLAGRMSPAFKAVEPAACPTLTKGVYAYDFGDTAGLTPLMKMHTL
GHGFVPDPIHAGGLRYHGMAPLISHVYELGFMEAIAIQQTECFDAALKFARTEGIIPAPE
PTHAIAAAIREAMECKRTGEKKVILMAMCGHGHFDLASYEKYLRGDMVDLSHSDEKLQEA
LAAVPKI
NT seq 1464 nt   +upstreamnt  +downstreamnt
atggccaccaccgcctccgtccgacctcccctgctccgacaagcagcaggttcagaaaaa
gcctcactcctttgcaaaccaaagcagagagcttctgtcagaagaagaagcttcactgcc
agggccagctcgaatcctgtgagcatcccgaagcaatggtacaacctcgtcgccgacctg
ccggtgaagccaccgccgccgctgcacccgcagacgcaccagccactgaaccctagtgac
ctgtcccctctcttccccgacgagctgatcaggcaggaggtgaccgaggagcggttcatc
gacatcccggaggaggtcgccgaggtttacaagctctggcgcccgacgccgctgatcagg
gcgaggaggctggagaagctgctgggcacgccggcgaagatctactacaagtacgagggg
acgagcccggcggggtcgcacaagccgaacacggcggtgccgcaggcgtggtacaacgcc
gccgccggggtgaggagcgtggtgacggagaccggcgccgggcagtggggcagcgcgctg
tcgttcgcgagcagcctgttcgggctcacctgcgaggtgtggcaggtgcgcgcgtcgtac
gaccagaagccgtaccggcggctgatgatggagacgtggggcgccacggtgcacccgtcg
ccgtcggcggcgacggagtcggggaggaggatcctggaacgcgacccggcgagcccgggc
agcctcgggatcgccatctcggaggcggtggaggtggcggcgagggacgccgacaccaag
tactgcctcggcagcgtgctcaaccacgtgctgctccaccagacggtgattggggaggag
tgcctggagcagctggcggccgccggcgacgtccccgacgtcgtcatcggctgcactggc
ggcgggtccaacttcggcgggctggtgttcccgttcatgcgcgagaagctcgccggcagg
atgagcccggcgttcaaggccgtcgagccggcggcgtgcccgacgctcaccaagggcgtc
tacgcctacgacttcggcgacaccgccggcctcacgccgctcatgaagatgcacaccctc
ggccatggattcgtccccgaccccatccatgcaggagggcttcgctaccatggaatggcg
ccactaatctcccatgtgtatgagcttggattcatggaagccattgccatccaacaaact
gaatgcttcgatgctgcgttgaaatttgcgcggacggaggggatcatcccggcgccggag
ccgacgcacgcgatcgcggcggcgatcagggaggcgatggagtgcaagaggacgggggag
aagaaggtgatcctgatggccatgtgcgggcacggccacttcgacctggcgtcctacgag
aagtacctgaggggcgacatggtcgacctctcccactccgacgagaagctgcaggaagcc
ctcgccgccgtccccaaaatctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342571
Entry
4342571           CDS       T01015                                 
Name
(RefSeq) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00260  Glycine, serine and threonine metabolism
osa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4342571
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    4342571
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     4342571
SSDB
Motif
Pfam: Trp_syntA His_biosynth PcrB FMN_dh NanE IGPS Spore_YtrH Ribul_P_3_epim
Other DBs
NCBI-GeneID: 4342571
NCBI-ProteinID: XP_015644552
UniProt: Q6ZL61 A0A0N7KN12
LinkDB
Position
7:complement(4330418..4333650)
AA seq 329 aa
MAFALKASTASAAAASTASASASSLSVAAAAPGRRGGAAGRVSFRGVPAPMVAIRAEAAA
VGEDERVISGTFAKLKEQGKTAFIPFITAGDPDLATTAKALKILDACGSDLIELGVPYSD
PLADGPVIQASATRALSKGTTFEDVISMVKEVIPELSCPVALFTYYNPILKRGIANFMTV
VKEAGVHGLVVPDVPLEETNILRSEAAKNNLELVLLTTPTTPTERMEKITKASEGFIYLV
STVGVTGARANVSGKVQSLLQDIKQVTDKAVAVGFGISTPEHVKQIAGWGADGVIIGSAM
VRQLGEAASPEEGLKKLEELAKSLKAALP
NT seq 990 nt   +upstreamnt  +downstreamnt
atggcgttcgcgctcaaggcctcaactgcctccgccgcggcggcgtccacggcctcggcc
tcggcctcgtccctgtccgtggctgcggccgcgcccgggaggcgcggcggcgcggcgggg
agggtctcgttccgcggggtccctgctcccatggtggcgatcagggcggaggcggctgcc
gtcggggaggacgagcgcgtcatctccggcaccttcgccaagctcaaggagcaggggaag
accgcattcattccattcatcactgctggtgaccctgacttggcgactacagcgaaagcg
ttgaagattcttgatgcttgtggttcggatctgatcgaattgggcgtgccttactctgac
ccattggctgatggccccgtcattcaggcttctgctacacgtgcactatcaaaaggcacc
acatttgaggatgttatctctatggtaaaggaggtgatacctgagctgtcctgccctgta
gcgcttttcacatattataacccgattctgaagcgtggcatcgcaaacttcatgactgtt
gtaaaagaagccggtgtccatggtcttgtggtacctgatgttcctctggaagagacaaat
attttgaggagtgaagctgctaagaacaaccttgagctggtgctactgacaacaccaact
acaccaacagaaagaatggagaaaattacaaaagcttctgaaggatttatttatcttgta
agcactgttggagttacaggtgcacgtgcaaatgtcagtggcaaggtgcaatctcttctc
caggatatcaagcaggtcacggacaaagctgtggctgttgggttcggtatatcgactcca
gagcatgtgaagcagattgcgggatggggcgcagatggtgtgatcattgggagcgctatg
gtgaggcaattgggcgaagctgcttcacccgaagaaggattgaagaagctagaagagcta
gccaagagcctgaaggctgcattgccctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344612
Entry
4344612           CDS       T01015                                 
Name
(RefSeq) tryptophan synthase beta chain 1
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00260  Glycine, serine and threonine metabolism
osa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4344612
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    4344612
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     4344612
SSDB
Motif
Pfam: PALP
Other DBs
NCBI-GeneID: 4344612
NCBI-ProteinID: XP_015650592
UniProt: Q6YYB9 A3BPF1
LinkDB
Position
8:2029737..2033085
AA seq 471 aa
MAAAVGNPNAAAAASISASRVGAGALRAGGLRVAAGRRGAGAVVAAAMRPAKAVASPAKE
AAGEVNGAASGGFARPDAFGRFGKFGGKYVPETLMHALTELEAAFHALAGDEDFQKELDG
ILKDYVGRETPLYFAERLTEHYKRADGTGPMIYLKREDLNHTGAHKINNAVAQVLLAKRL
GKERIIAETGAGQHGVATATVCARFGLQCIIYMGAQDMERQALNVFRMKLLGAEVRAVHS
GTATLKDATSEAIRDWVTNVENTHYILGSVAGPHPYPMMVREFHKVIGKETRRQAMEKWG
GKPDVLVACVGGGSNAMGLFHEFVDDQDIRMIGVEAAGYGVDTDKHAATLTKGEVGVLHG
SLSYVLQDDDGQVIEPHSISAGLDYPGVGPEHSFLKDIGRAEYDSVTDQEALDAFKRVSR
LEGIIPALETSHALAYLEKLCPTLPDGVRVVVNCSGRGDKDVHTASKYLDV
NT seq 1416 nt   +upstreamnt  +downstreamnt
atggccgccgccgtcgggaaccctaacgcggccgccgctgcgtcgatctcggcgtcgagg
gtcggtgcgggggcgttgcgcgcggggggcttgagggtggcggcggggaggaggggagcg
ggggctgtggtggcggcggcaatgcggccggcgaaggcggtggcgtcgccggcgaaggag
gcggccggggaggtgaacggggcggcgtcgggggggttcgcgaggcccgacgcgttcggg
aggttcgggaagttcgggggcaagtacgtgcccgagacgctgatgcatgcgctcaccgag
ctcgaggccgcgttccatgccctcgccggcgacgaagatttccagaaagaacttgatggt
attctcaaggattacgtcggccgggagaccccgctgtactttgcggagcgattgactgag
cactacaagcgcgctgatggcacaggccccatgatttacctcaagagggaggatcttaac
cacactggcgcccacaagatcaacaatgctgtcgctcaagtcttgcttgccaagcggctt
gggaaggaacgtatcatcgccgagactggcgccggccagcacggtgttgccactgccacg
gtgtgcgcgaggtttgggctgcagtgcatcatctacatgggtgctcaggatatggagagg
caggcacttaatgttttcaggatgaagcttcttggagcagaggtgagggcagtacattct
gggacagcaactttgaaggatgccacctcggaggccatccgtgactgggtcaccaatgtt
gagaacactcactacattttgggatcagttgctggtccgcatccatacccgatgatggtg
agagagttccataaggtgattggcaaggagacccgtagacaggccatggagaagtggggt
ggcaagcctgatgtcttggttgcttgtgttggtggtggatcaaacgccatgggtctcttc
catgagttcgttgatgatcaagatataagaatgattggagtggaggctgctggctatggt
gtagacactgacaaacatgctgccactttgacaaagggagaagtgggagttctccatgga
tcattgagctatgtgttgcaggatgatgatggacaagttattgaaccccactccattagt
gctgggctggactaccctggtgttgggcctgagcatagctttttgaaggatattggacgt
gctgaatatgacagcgtgacagatcaggaggcactggatgctttcaagcgcgtctctcgg
ctggagggcatcatccctgctctggagacgtcccatgcgctcgcctacctggagaagctc
tgcccaacgctgcccgacggcgtgagggtggtggtgaactgcagtggaagaggagacaag
gatgtccacacagccagcaagtaccttgatgtctga

DBGET integrated database retrieval system