KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334438
Entry
4334438           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S15-like
  KO
K02958  small subunit ribosomal protein S15e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4334438
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4334438
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4334438
SSDB
Motif
Pfam: Ribosomal_S19 ALC FliH
Other DBs
NCBI-GeneID: 4334438
NCBI-ProteinID: XP_015632818
UniProt: Q851P5 Q7G7B0
LinkDB
Position
3:complement(33290763..33293355)
AA seq 154 aa
MADVEVEAEVAAAGAPKKRTFRKYSYRGVDLDALLDMSTDDLVQLFPARARRRFQRGLKR
KPMALIKKLRKAKKDAPAGEKPEPVRTHLRNMIIVPEMIGSIVGVYNGKTFNQVEIKPEM
IGHYLAEFSISYKPVKHGRPGIGATHSSRFIPLK
NT seq 465 nt   +upstreamnt  +downstreamnt
atggcggatgtcgaggtcgaggcggaggtggccgcggccggagcgccgaagaagaggacg
ttccgcaagtacagctaccgcggcgtggacctcgacgcgctcctcgacatgtccaccgac
gacctcgtccagctcttccccgcgcgcgcccgcagaaggttccagaggggcctgaagagg
aagcccatggcgctcatcaagaagctccgcaaggcgaaaaaggatgcacctgctggtgag
aagccagagcctgtgaggacccacctcaggaacatgatcattgtgcctgagatgatcgga
agcatcgtcggtgtctacaacggcaagaccttcaaccaggttgagatcaagcctgagatg
attggccactacctcgcagagttctccatctcgtacaagccagtcaagcacggtaggcct
ggtattggtgctacccactcctcacggtttatccctctcaagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342580
Entry
4342580           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S15
  KO
K02958  small subunit ribosomal protein S15e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4342580
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4342580
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4342580
SSDB
Motif
Pfam: Ribosomal_S19 ALC FliH
Other DBs
NCBI-GeneID: 4342580
NCBI-ProteinID: XP_015647750
UniProt: P31674 B9FVV5
LinkDB
Position
7:complement(4460586..4462700)
AA seq 154 aa
MADVEVETEVAAGAQPKKRTFRKYSYRGVDLDALLDMSTDDLVQLFPARARRRFQRGLKR
KPMALIKKLRKAKKDAPAGEKPEPVRTHLRNMIIVPEMIGSIVGVYNGKTFNQVEIKPEM
IGHYLAEFSISYKPVKHGRPGIGATHSSRFIPLK
NT seq 465 nt   +upstreamnt  +downstreamnt
atggcggacgtcgaagtcgagacggaggtcgccgccggcgcacagccaaagaagaggacg
ttccgcaagtacagctaccgcggcgtcgacctcgacgcgctcctcgacatgtccaccgat
gacctcgtccagctcttccccgcgcgcgcccgcagaaggttccagaggggtctgaagagg
aagcccatggcgctcatcaagaagctgcgcaaggcgaaaaaggatgcccctgctggcgag
aagccagagccagtgaggacccacctccgcaacatgatcattgtccctgagatgatcgga
agcatcgtcggtgtctacaatggcaagaccttcaaccaggttgagattaagcctgagatg
attggtcactaccttgcggagttctccatctcctacaagccggttaagcacggtaggccc
ggtattggtgccacccactcctctcggttcatccctctcaaatga

DBGET integrated database retrieval system