KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334460
Entry
4334460           CDS       T01015                                 
Name
(RefSeq) FAD synthetase, chloroplastic
  KO
K22949  FAD synthetase [EC:2.7.7.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00740  Riboflavin metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Module
osa_M00125  Riboflavin biosynthesis, plants and bacteria, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    4334460
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.2  FAD synthase
     4334460
SSDB
Motif
Pfam: FAD_syn CTP_transf_like DUF4838
Other DBs
NCBI-GeneID: 4334460
NCBI-ProteinID: XP_015628716
UniProt: Q10BX9
LinkDB
Position
3:complement(33433222..33436731)
AA seq 391 aa
MERGAAAAGALSCTFRSPSPSPTSPAAPHWRPLLGFRSRSRSRGRGWGQRAVVAGAPRLF
LPPPCRRFRYCSQSKLLGTNKGQNRCSLATFSSFGQSGISLNNEDLVKDKLLIDCGEDQD
CVIDGIVALGKFDALHIGHRELAMYASKAGTPFLLSFVGIAEVLGWEYRPPIVAQCDRKR
VLTSWAPYCKNVVPIEYQVEFSKVRYLTPRQFVERLSRDLKIQGVVAGENYRFGYRASGD
AAELVKLCEEFGLSAFIVRSVMDTARSYNGVTTSVNSSDKGQVSSSRVRHALAMGDMEYV
SELLGRKHRLVLTVKENHLQERKRIMLPKSCMLNMPPADGLYENCDLLNGGHLGLCRVII
NSETIVIEMKDENSLLPNTIQENQQLGIEFG
NT seq 1176 nt   +upstreamnt  +downstreamnt
atggagaggggcgccgccgccgcaggagcgctctcatgcaccttccgctccccttcccct
tccccgacgtccccggccgcgccccattggcggcctctcctcggcttccgctcccgctcc
cgctcgcgtggccggggctggggccagcgcgcggtggtcgccggggcaccgcggttattc
ctgccgccaccatgccggcgcttcagatactgcagtcaaagcaagcttctaggcacgaac
aaagggcaaaacagatgctcgttggcaactttcagctcatttggacagtcagggatcagt
ctgaacaatgaagatttagtgaaagataagctcctaatagattgtggggaagatcaagat
tgtgtgattgatgggatagttgccttgggaaagtttgatgcccttcacattggccatcga
gaattggcaatgtatgcttctaaggcaggaactccctttcttctttcttttgtgggaatt
gctgaggttcttggctgggagtataggcctcctatagttgctcagtgtgatcggaagcga
gtgctcacctcttgggctccatactgtaagaatgtagtgcctattgaatatcaagttgag
ttttcaaaggtcaggtacctaactccgcggcaattcgttgagaggttatcaagggatctt
aaaatacaaggtgttgtagcaggtgaaaactacagatttggctacagggcatctggcgat
gcagctgagctagtgaaactatgtgaagaatttggtttaagtgcatttattgtacggtca
gtcatggacacagctagatcttataatggagttacaacctccgtaaattcaagcgacaag
gggcaggtttcttctagtcgtgttcgccatgctttggctatgggtgatatggaatatgtt
tctgaattactagggaggaaacaccgccttgtgctgacagttaaggaaaaccaccttcag
gaaaggaaaaggatcatgctgccaaaatcttgcatgttgaacatgccaccagctgatggt
ttgtatgagaattgtgaccttcttaatggaggccatcttggactatgcagggtgatcata
aactcagagaccattgtaattgagatgaaagatgagaacagtttattaccaaatactatt
caagaaaatcagcaattaggtattgaatttggatga

DBGET integrated database retrieval system