KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334492
Entry
4334492           CDS       T01015                                 
Name
(RefSeq) squalene synthase
  KO
K00801  farnesyl-diphosphate farnesyltransferase [EC:2.5.1.21]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00100  Steroid biosynthesis
osa00909  Sesquiterpenoid and triterpenoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    4334492
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    4334492
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:osa01006]
    4334492
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.21  squalene synthase
     4334492
Prenyltransferases [BR:osa01006]
 Terpene biosynthesis
  Squalene/phytoene synthase
   4334492
SSDB
Motif
Pfam: SQS_PSY PhoU_div
Other DBs
NCBI-GeneID: 4334492
NCBI-ProteinID: XP_015630544
UniProt: O22105 Q0DMJ9
LinkDB
Position
3:33605269..33612412
AA seq 403 aa
MGVLSRPEEVLPLVKLRVAAGRIKRQIPPEEHWAFAYTMLQRVSRSFALVIQQLGPDLRN
AVCIFYLVLRALDTVEDDTSIPAAVKVPILKEFHRHIYNRDWHYSCGTKDYKLLMDKFRL
VSTAFLELGQGYQEAIEEITRLMGAGMAKFICKEVETVDDYNEYCHYVAGLVGYGLSRLF
HAGGTEDLASDSLSNSMGLFLQKINIIRDYLEDINEIPKSRMFWPREIWSKYVNKLEDLK
YEENSEKAVQCLNDMVTNALSHAEDCLQYMSALKDHAIFRFCAIPQIMAIGTCAICYNNV
NVFRGVVKMRRGLTARVIDETNTMSDVYTAFYEFSSLIESKIDNNDPNASLTRKRVDAIK
RTCKSSCSLKRRGYDLEKSKYNSMLIMVVLLLVAIVLGMIYAK
NT seq 1212 nt   +upstreamnt  +downstreamnt
atgggggtgctgtcgaggccggaggaggtgttgccgctggtgaagctgcgggtggcggcg
gggcggatcaagcggcagatcccgccggaggagcactgggccttcgcctacaccatgctg
cagagggtctcccggagcttcgcgctcgtcatccagcagctcggccccgacctccgcaat
gccgtgtgcatcttctatctcgtgctccgagccctcgacactgttgaggacgacactagc
attcctgccgcggtgaaggtgccgatccttaaggaattccatcggcatatctacaaccgc
gactggcattattcatgtggaacaaaagactacaaattactgatggataagtttcgcctt
gtctccacggctttcttggagcttggtcaaggttatcaagaggcaattgaagaaatcact
aggctaatgggagcaggaatggcaaaatttatctgcaaggaggttgaaactgttgatgac
tacaatgagtactgtcactatgtagcagggctagtggggtatgggctttccaggctcttt
catgctggtgggacggaagatctggcttcagattcactttcaaattcaatgggcttgttt
ctgcagaaaatcaatataattagggattatttggaggacataaacgagataccaaagtca
cgtatgttctggcctcgagaaatatggagtaaatatgtcaataaactcgaggatttgaaa
tacgaggaaaattcagaaaaggcagttcagtgtttgaatgatatggtgactaacgctctg
tctcatgctgaagactgcctccaatacatgtcagcattgaaggatcatgccattttccgt
ttttgtgcaatacctcagataatggcaattgggacatgtgctatttgctacaataatgtg
aatgtctttagaggagttgttaagatgaggcgtgggctcactgcacgagtaattgatgag
acaaacacaatgtcagatgtctatactgctttctatgagttctcttcgctgatagaatcg
aagattgataataatgatccaaatgcttccctaacgcggaaacgtgttgatgcgataaag
agaacctgcaagtcatcttgctcactaaagagaaggggatacgatttggagaagtcaaag
tacaactccatgctgataatggttgtacttctgttggtggctattgttttgggcatgata
tatgccaagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342663
Entry
4342663           CDS       T01015                                 
Name
(RefSeq) squalene synthase isoform X1
  KO
K00801  farnesyl-diphosphate farnesyltransferase [EC:2.5.1.21]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00100  Steroid biosynthesis
osa00909  Sesquiterpenoid and triterpenoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    4342663
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    4342663
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:osa01006]
    4342663
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.21  squalene synthase
     4342663
Prenyltransferases [BR:osa01006]
 Terpene biosynthesis
  Squalene/phytoene synthase
   4342663
SSDB
Motif
Pfam: SQS_PSY
Other DBs
NCBI-GeneID: 4342663
NCBI-ProteinID: XP_015644684
UniProt: Q6Z368 B9FW21
LinkDB
Position
7:5440359..5445910
AA seq 410 aa
MGVVGALLGPEAEALVRLRAAAWRLRREVAAATDDDEHWAFAYSMLHRVSRSFAIVIQQL
GPDLRNAVCVFYLVLRALDTVEDDTSIPTEIKVPILQEFHRHIYNRDWHFSCGTKDCKIL
MDKFHYVLTAFLELGSGYQEAIEEITRRMGAGMAKFICKEVETVDDYDEYCHYVAGLVGI
GLSRLFHAAGLEDLAPESLSNSMGLFLQKVNITRDYLEDINEIPKSRMFWPREIWSKYVD
KLEDLKYENNSVKAVKCLNEMVTNGLIHTEDCLRYMSALKDITILRFCAIPQVMALATYA
LCYNNVNVFRGVVKLRRGLTARIINETNSMADVYTAFYEFSSLLAEKIDDNDPNASLTRK
RVNAIKETCKSSGLLKIRGYDLDRPKRNPAMIMMLLLLLVAIFLGALYRR
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgggggtggtgggggcgttgctgggaccggaggcggaggcgctggtgaggctgcgggcg
gcggcgtggcggctgcggagggaggtcgccgccgccaccgacgacgacgagcactgggcc
ttcgcctactccatgctgcaccgcgtctcccgcagcttcgccatcgtcatccagcagctc
ggccccgacctccgcaatgccgtgtgcgtcttctacctcgtgcttcgggcgctcgacacc
gtcgaagatgatactagcatccctactgagattaaggtgcccattcttcaggaattccac
cgtcatatctataaccgggattggcatttctcatgtggaacaaaggactgcaagattctg
atggataaattccactatgttttgacagctttcttggagcttggttcaggataccaagag
gcaattgaagaaattaccaggagaatgggtgcaggaatggcaaagtttatatgcaaggag
gttgaaactgttgatgattatgatgagtactgtcactatgtggcagggctagtcggcatt
ggactttcaaggctctttcatgctgctgggttagaagatcttgctcccgaatcgctttct
aattcaatgggtttatttttgcagaaagtcaatattactcgggattacctggaggacata
aatgagataccaaaatcacgcatgttctggccacgagaaatatggagtaaatatgttgac
aaacttgaggatctcaaatacgaaaataattcagtgaaggcagtaaaatgcttgaatgag
atggtgactaatggtttaatacatactgaagattgccttcggtatatgtctgctctaaag
gatattactattctccgtttttgtgcaataccccaggtaatggcacttgcaacctatgct
ctgtgctataacaatgtgaatgtatttcgaggagttgtgaagttgaggcgtgggctgact
gcacgaataatcaatgaaacaaattctatggctgatgtgtacactgctttctatgaattc
tcttcactgcttgcagaaaagattgatgataatgatccaaatgcgtcgcttacacggaaa
cgtgtgaatgcaataaaggagacctgcaaatcatccggtttgctgaagataaggggatat
gacttggataggccaaaaaggaaccctgctatgatcatgatgctactgctgctcttggta
gctattttcttgggagctctgtataggaggtga

DBGET integrated database retrieval system