KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334528
Entry
4334528           CDS       T01015                                 
Name
(RefSeq) RNA-binding protein 8A
  KO
K12876  RNA-binding protein 8A
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03013  Nucleocytoplasmic transport
osa03015  mRNA surveillance pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4334528
  09122 Translation
   03013 Nucleocytoplasmic transport
    4334528
   03015 mRNA surveillance pathway
    4334528
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4334528
   03041 Spliceosome [BR:osa03041]
    4334528
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     4334528
Spliceosome [BR:osa03041]
 Complex C
  Other components
   EJC/TREX
    4334528
SSDB
Motif
Pfam: RRM_1 RRM_5 RRM_3 RRM_7
Other DBs
NCBI-GeneID: 4334528
NCBI-ProteinID: XP_015632650
UniProt: Q6ATR0
LinkDB
Position
3:33894791..33899648
AA seq 197 aa
MAAAAEDVEFVDYDRDEEEEEDAMDEDDRGGGRGGRALPVPHIVSQGVMRSRGRLLGRST
SVLASNRDRFDSLADAGNPGHGPQRSIEGWILLVSGVKEDAEEDDLYNTFSDFGHVKDLH
LNLERRTGYAKGYALVEYESFEEAQTAIKAMNGTQLLTRTVYVDWAFSRGPIQKLTSTRP
LHRRSRTPPRRLAALTC
NT seq 594 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggaggacgtggagttcgtcgactacgaccgcgacgaggaggaggag
gaggacgccatggacgaggacgatcggggcggtggccgcggcgggcgcgcgctacccgta
ccccacatcgtctcccagggcgtgatgcgctcgcgcggccgcctcctcggccgcagcacc
tccgtgctcgcctccaaccgcgaccgcttcgactccctcgccgatgccggcaaccccggc
cacggcccacagcgctctattgaaggatggatactactggtctctggagtcaaagaagac
gcggaagaagatgatctgtacaacactttcagtgattttggtcatgttaaggacctacat
ttaaatctggaacgccgcactggatatgccaagggatatgcattagttgaatatgaaagt
tttgaggaagcacaaactgcaatcaaagcaatgaatgggactcagctgttaacaaggact
gtctatgttgactgggcattcagcagaggtcctatacagaaactcaccagtacaaggcca
ttacatcggcgatctcggactccacctcgcaggcttgctgccttgacatgttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337757
Entry
4337757           CDS       T01015                                 
Name
(RefSeq) RNA-binding protein 8A
  KO
K12876  RNA-binding protein 8A
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03013  Nucleocytoplasmic transport
osa03015  mRNA surveillance pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4337757
  09122 Translation
   03013 Nucleocytoplasmic transport
    4337757
   03015 mRNA surveillance pathway
    4337757
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4337757
   03041 Spliceosome [BR:osa03041]
    4337757
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     4337757
Spliceosome [BR:osa03041]
 Complex C
  Other components
   EJC/TREX
    4337757
SSDB
Motif
Pfam: RRM_1 RRM_3 RRM_5
Other DBs
NCBI-GeneID: 4337757
NCBI-ProteinID: XP_015637539
UniProt: B7FAL5
LinkDB
Position
5:2331050..2334249
AA seq 204 aa
MAAVTNADVEAVDFDPDDDDLMDEDAADPTPAPAPRLRSTIAGGGGGGGGGDDGQRKTKG
RGFRDDAAPRDSRLAGAGRASDFDSLGSDGGPGPVRSIEGWIVLVTGVHEEAQEDDLHNI
FRDFGQVKNLHLNLDRRTGFVKGYALIEYETFEEAQAAIKALDGTELLTQIISVDWAFSN
GPVKRRNIRKRSPRRSRSPPRRRY
NT seq 615 nt   +upstreamnt  +downstreamnt
atggctgcggtgaccaacgccgatgtggaggcggtcgacttcgaccccgatgacgacgac
ctcatggacgaggacgccgccgaccccacgccggcgcccgccccgcgcctccgctccacc
atcgcgggcggcggcggcggcggcggcggcggcgacgacgggcaacgcaagaccaagggc
cgcgggttccgcgacgacgccgcgccccgcgactcccgcttagccggcgccgggcgcgcc
tccgacttcgactccctcggctccgacggtggccctggccccgtccgatccattgaagga
tggattgtgctagtcactggggttcatgaagaagctcaggaagatgatcttcacaatatt
ttccgggactttgggcaggtcaagaacttgcatttgaatttggatcgccgaactggattc
gtgaagggatatgctcttattgagtatgaaactttcgaggaagctcaggctgcaataaaa
gcattggatggaactgagcttctaacacaaatcataagtgttgattgggcatttagtaat
ggccctgtcaagcgcaggaatattcggaagagatcaccaagacgctccagatccccaccg
aggagaagatactga

DBGET integrated database retrieval system