KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334590
Entry
4334590           CDS       T01015                                 
Name
(RefSeq) ras-related protein RABE1c
  KO
K07901  Ras-related protein Rab-8A
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4334590
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4334590
   03036 Chromosome and associated proteins [BR:osa03036]
    4334590
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4334590
   04031 GTP-binding proteins [BR:osa04031]
    4334590
Membrane trafficking [BR:osa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab GTPases
    4334590
 Autophagy
  Other autophagy associated proteins
    4334590
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Centrosome formation proteins
   Other centriole associated proteins
    4334590
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4334590
  Exosomal proteins of other body fluids (saliva and urine)
   4334590
  Exosomal proteins of colorectal cancer cells
   4334590
GTP-binding proteins [BR:osa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab8/10/13 [OT]
    4334590
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 Gtr1_RagA RsgA_GTPase SRPRB AAA_29 AAA_16 AAA_22
Other DBs
NCBI-GeneID: 4334590
NCBI-ProteinID: XP_015627857
UniProt: Q84TA8 Q0DMA8
LinkDB
Position
3:34407070..34410412
AA seq 214 aa
MAAPPARARADYDYLIKLLLIGDSGVGKSCLLLRFSDGSFTTSFITTIGIDFKIRTVELD
GKRIKLQIWDTAGQERFRTITTAYYRGAMGILLVYDVTDESSFNNIRNWIRNIEQHASDN
VNKILVGNKADMDESKRAVPTSKGQALADEYGIKFFETSAKTNLNVEQVFFSIARDIKQR
LSETDSKPEDRTIKIKSEGEAEAAAAQKSACCGS
NT seq 645 nt   +upstreamnt  +downstreamnt
atggcggcgccgccggctagggctcgggccgactacgattatctcatcaagctgctcctc
attggcgacagcggtgtaggaaaaagttgtctcctcctacggttctcagatggctctttc
acgactagtttcattaccacaattggtattgacttcaagataaggaccgttgagttggat
ggtaaacggattaaattgcaaatctgggatactgctggccaagaacgctttcgaactatt
accactgcttactacaggggagcaatgggcattttactcgtttatgatgtcaccgatgaa
tcttcattcaacaacataagaaattggatcagaaacatcgaacaacatgcctctgataat
gtgaacaaaattttggtggggaacaaagctgatatggatgaaagcaaaagggctgtaccc
acttcaaagggacaggctcttgctgatgaatacggaatcaagttctttgaaacgagtgca
aagacaaacctgaatgttgagcaggttttcttttctatagcaagagatatcaaacaaaga
ctctcagagactgattccaagcctgaggaccgaaccatcaagatcaaatcggaaggggaa
gccgaggcagcggcggctcagaaatcagcttgctgtggatcttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339021
Entry
4339021           CDS       T01015                                 
Name
(RefSeq) ras-related protein RABE1c isoform X1
  KO
K07901  Ras-related protein Rab-8A
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4339021
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4339021
   03036 Chromosome and associated proteins [BR:osa03036]
    4339021
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4339021
   04031 GTP-binding proteins [BR:osa04031]
    4339021
Membrane trafficking [BR:osa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab GTPases
    4339021
 Autophagy
  Other autophagy associated proteins
    4339021
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Centrosome formation proteins
   Other centriole associated proteins
    4339021
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4339021
  Exosomal proteins of other body fluids (saliva and urine)
   4339021
  Exosomal proteins of colorectal cancer cells
   4339021
GTP-binding proteins [BR:osa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab8/10/13 [OT]
    4339021
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase Gtr1_RagA SRPRB AAA_29 PduV-EutP AAA_16 AAA_22
Other DBs
NCBI-GeneID: 4339021
NCBI-ProteinID: XP_015640739
UniProt: A0A0P0WN94 Q6L502
LinkDB
Position
5:complement(22649304..22652556)
AA seq 216 aa
MAAPPARARADYDYLIKLLLIGDSGVGKSCLLLRFSDGSFTTSFITTIGIDFKIRTIELD
GKRIKLQIWDTAGQERFRTITTAYYRGAMGILLVYDVTDESSFNNIRNWIRNIEQHASDN
VNKILVGNKADMDESKRAVPTAKGQALADEYGIKFFETSAKTNLNVEQVFFSIARDIKQR
LAETDSKPEDKTIKINNKTDQGADKPAASGSACCGS
NT seq 651 nt   +upstreamnt  +downstreamnt
atggctgcgccgccggcgagggctcgggcggactacgactacctcatcaagctcctcctc
atcggggacagcggtgttggcaagagttgccttctcctgcggttttctgatggttccttc
actacaagctttattaccacaattggtattgacttcaaaattagaacaatagagctggac
gggaagcgtattaagctacaaatttgggacacagctggccaagaacgtttccggacaatt
accactgcgtactaccgtggagccatgggtatcctgcttgtttatgatgtcaccgacgag
tcatctttcaacaacattcggaactggattcggaatattgagcaacatgcctctgataat
gtcaacaaaattttggttggcaacaaggctgatatggatgagagtaaaagggctgtccct
actgcgaaaggccaagcactggctgatgagtatggcatcaaatttttcgaaactagtgcg
aagacaaacctcaacgtggagcaagtttttttctccattgcacgtgacattaagcagagg
cttgctgagaccgactccaagcctgaggacaagacaatcaagattaacaacaagacggat
cagggtgccgacaaaccagcagcttctggatctgcatgctgcggctcctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342644
Entry
4342644           CDS       T01015                                 
Name
(RefSeq) ras-related protein RABE1d
  KO
K07901  Ras-related protein Rab-8A
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4342644
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4342644
   03036 Chromosome and associated proteins [BR:osa03036]
    4342644
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4342644
   04031 GTP-binding proteins [BR:osa04031]
    4342644
Membrane trafficking [BR:osa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab GTPases
    4342644
 Autophagy
  Other autophagy associated proteins
    4342644
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Centrosome formation proteins
   Other centriole associated proteins
    4342644
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4342644
  Exosomal proteins of other body fluids (saliva and urine)
   4342644
  Exosomal proteins of colorectal cancer cells
   4342644
GTP-binding proteins [BR:osa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab8/10/13 [OT]
    4342644
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 Gtr1_RagA SRPRB FeoB_N AAA_16 AAA_7 AAA_29 MCM AAA_22 PduV-EutP AAA_5 AAA_25
Other DBs
NCBI-GeneID: 4342644
NCBI-ProteinID: XP_015647321
UniProt: Q6ZKZ4 B7EW63
LinkDB
Position
7:complement(5145086..5148769)
AA seq 215 aa
MAGAPSRSRGDFDHLIKLLLIGDSGVGKSCLLLRFSDDTFTTSFITTIGIDFKVRTVELD
GKRVKLQIWDTAGQERFRTITTAYYRGAMGILLVYDVTDESSFNNIRNWIRNIEQHASDN
VNKILVGNKVDMDTKRVVSTAQGQKLADEYGMKFFETSAKTNQNVEQVFFTIARDIKQRL
TETVAAAAEPPTIQISRQEPDQAAASSRWSACCNT
NT seq 648 nt   +upstreamnt  +downstreamnt
atggcgggggctccgtcgaggtcgcgcggcgacttcgaccacctcatcaagctcctcctc
atcggcgacagcggagtaggaaagagttgcttgcttctgaggttctcagatgacactttc
actacaagttttatcaccaccattggcattgatttcaaggttcggacagttgagcttgat
ggaaagcgtgtaaaattgcagatttgggatactgctggtcaagaacgtttccggacaatt
acaactgcctactatagaggtgctatgggcattctgcttgtttatgatgttacagacgag
tcatccttcaacaacattagaaattggatccgcaacatagaacaacatgcatctgataat
gtcaacaagattttggtgggcaacaaggttgatatggatacaaagcgggtggtgtccaca
gctcaaggacaaaagctcgcagatgagtatggaatgaaattttttgagacgagtgcaaaa
acaaatcagaacgtggagcaggtattctttaccattgcaagggacataaagcaaagattg
accgaaactgttgctgcagcagctgagcccccaactattcaaatcagtaggcaagaacca
gatcaggcagctgcctcgtcaagatggtcagcctgctgtaacacctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342802
Entry
4342802           CDS       T01015                                 
Name
(RefSeq) ras-related protein RABE1c
  KO
K07901  Ras-related protein Rab-8A
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4342802
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4342802
   03036 Chromosome and associated proteins [BR:osa03036]
    4342802
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4342802
   04031 GTP-binding proteins [BR:osa04031]
    4342802
Membrane trafficking [BR:osa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab GTPases
    4342802
 Autophagy
  Other autophagy associated proteins
    4342802
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Centrosome formation proteins
   Other centriole associated proteins
    4342802
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4342802
  Exosomal proteins of other body fluids (saliva and urine)
   4342802
  Exosomal proteins of colorectal cancer cells
   4342802
GTP-binding proteins [BR:osa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab8/10/13 [OT]
    4342802
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 Gtr1_RagA RsgA_GTPase AAA_29 AAA_16 AAA_22 PduV-EutP
Other DBs
NCBI-GeneID: 4342802
NCBI-ProteinID: XP_015647647
UniProt: Q7XHP7 Q0D7K0
LinkDB
Position
7:complement(7743066..7746776)
AA seq 215 aa
MAAPPARARADYDYLIKLLLIGDSGVGKSCLLLRFSDGSFTTSFITTIGIDFKIRTIELD
GKRIKLQIWDTAGQERFRTITTAYYRGAMGILLVYDVTDESSFNNIRNWIRNIEQHASDN
VNKILVGNKADMDESKRAVPTSKGQALADEYGIKFFETSAKTNLNVEQVFFSIARDIKQR
LAETDSKTEDRTIKINKPEGDAEATTLQKSACCGS
NT seq 648 nt   +upstreamnt  +downstreamnt
atggcggcgccgccggcgagggctcgggccgactacgattacctcatcaagctgctcctc
atcggcgacagcggtgttgggaaaagttgtctcctcctacggttctctgatggttccttc
accaccagttttattaccaccatcgggattgatttcaaaataagaacaatcgaactggat
ggtaaacggattaaacttcaaatctgggatacagctggtcaagaacgtttccgaactatt
acaactgcctactacaggggagcaatgggtattttgcttgtttatgatgtcaccgacgag
tcatcatttaataatataagaaactggattaggaacatagagcaacatgcttccgataat
gtgaacaagattttggtaggcaacaaagctgacatggatgaaagcaaaagggccgtacca
acttcaaaggggcaagcacttgctgatgaatatggcatcaagttctttgaaacgagtgca
aagacaaacctgaatgtcgagcaggttttcttttcaatagcaagggatattaagcaaaga
cttgcggagactgattccaagactgaggatcgcacgatcaagatcaacaaaccagagggt
gatgctgaggccacaactttgcagaaatctgcatgctgtggatcgtga

DBGET integrated database retrieval system