KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334655
Entry
4334655           CDS       T01015                                 
Name
(RefSeq) acylpyruvase FAHD1, mitochondrial
  KO
K01557  acylpyruvate hydrolase [EC:3.7.1.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00350  Tyrosine metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    4334655
Enzymes [BR:osa01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.5  acylpyruvate hydrolase
     4334655
SSDB
Motif
Pfam: FAA_hydrolase
Other DBs
NCBI-GeneID: 4334655
NCBI-ProteinID: XP_015628291
UniProt: Q10B63
LinkDB
Position
3:complement(34817166..34820387)
AA seq 226 aa
MAAAAQRLLAASTKIVGVGRNFVAHAKELGNPVPKEPVLFLKPTSSFLHAGVAGAAIEVP
EPVESLHHEVELAVVISQRARDVPEASAMDFVGGYALALDMTARELQSAAKSAGLPWTLG
KAQDTFTPISAVIPKSDVANPDDLELWLKVDDELRQKGSTSDMIFKIPSLISYISSIMTL
MEGDVILTGTPEGVGPVRPGQKIKAGITGLIDVEFDVQKRKRSFST
NT seq 681 nt   +upstreamnt  +downstreamnt
atggcggcggcggcgcagaggctcctggcggccagcacgaagatcgtaggggtgggccgc
aacttcgtcgcccacgccaaggagctcgggaaccccgtccccaaggagccggtgctgttc
ctgaagcccacctcgtcgttcctccacgcgggcgtggccggcgccgccatcgaggtgccg
gagccggtcgagtcgctgcaccacgaggtcgagcttgccgttgtcatctcccagcgcgcg
cgcgacgtccccgaagcatccgccatggacttcgtaggaggttatgcacttgctttggac
atgacagcaagagaacttcagtctgcggctaagtctgcaggtcttccttggactttgggt
aaagcacaggacaccttcactccaattagtgcagtgattccaaaatcagatgtagctaat
cctgatgatctagagctctggctaaaggttgatgatgaacttaggcagaagggatctaca
agtgatatgatattcaagataccatctctaataagttatatcagttccatcatgacatta
atggagggtgatgttatactgaccggtactcctgagggtgtaggcccagtacgaccagga
cagaagatcaaagctggtataaccggcctcattgatgttgagtttgatgttcagaagcgc
aagcggtcattttctacttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9266575
Entry
9266575           CDS       T01015                                 
Name
(RefSeq) acylpyruvase FAHD1, mitochondrial
  KO
K01557  acylpyruvate hydrolase [EC:3.7.1.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00350  Tyrosine metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    9266575
Enzymes [BR:osa01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.5  acylpyruvate hydrolase
     9266575
SSDB
Motif
Pfam: FAA_hydrolase
Other DBs
NCBI-GeneID: 9266575
NCBI-ProteinID: XP_015629542
LinkDB
Position
3:17557911..17560286
AA seq 279 aa
MKPKRIDRYYGPLVGRSCYQGLIFCHLTTRWSHRSRHPHAAARSSPPAAMAAAAAAAAQR
LLAASTKIIGVGRNYVAHAKELGNPVPKEPLLFLKPTSSFLHAGVAGAAIEVPGPVESLH
HEVELAVVLSQRARDVPEASAMDFVGGYALALDMTAREFQSAAKSAGLPWTLCKAQDTFT
PISAVIPKSAVANPNDLELWLKVDDELRQKGSTSDMIFKIPSLISYISSIMTLMEGDVIL
TGTPEGVGPVRPGQKIKAGITGLVDVEFDVQKRKRSFST
NT seq 840 nt   +upstreamnt  +downstreamnt
atgaagccaaagcgcatagaccgatattatgggccgttagtgggccgatcttgttaccag
ggccttatattttgtcacttgactacgcgctggagtcatcgatcgaggcatccccacgcc
gcagctcgcagctctcctccggcggcaatggcggcagcggcggcggcggcggcgcagagg
ctcctggcggccagcacgaagatcatcggggtcggccgcaactacgtcgcccacgccaag
gagctcgggaaccccgtccccaaggagccgctgctgttcctgaagcccacctcgtcgttc
ctccacgcgggcgtcgccggcgccgccatcgaagtgccggggccggtcgagtcgctgcac
cacgaggtcgagctcgccgtcgttttgtcccagcgcgcgcgcgatgtccccgaggcatct
gccatggacttcgtcggaggttatgcgcttgctttggacatgacagcaagagaatttcaa
tctgctgctaagtctgcgggtcttccttggactttgtgtaaagcacaggacaccttcact
ccaattagtgcagtgattccaaaatcagctgtcgctaatcctaatgatctagagctctgg
ctaaaggttgatgatgaacttaggcagaagggatctacgagtgatatgatatttaagata
ccatctctaatcagttatatcagttccatcatgacattaatggagggtgatgttatattg
accggtactcctgagggtgtaggcccagtacgaccaggacagaagatcaaagctggtata
accggcctcgttgatgttgagtttgatgttcagaagcgcaaacggtcattttctacttaa

DBGET integrated database retrieval system