KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334671
Entry
4334671           CDS       T01015                                 
Name
(RefSeq) phosphoribosylformylglycinamidine cyclo-ligase, chloroplastic
  KO
K01933  phosphoribosylformylglycinamidine cyclo-ligase [EC:6.3.3.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00048  De novo purine biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4334671
Enzymes [BR:osa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.3  Cyclo-ligases
    6.3.3.1  phosphoribosylformylglycinamidine cyclo-ligase
     4334671
SSDB
Motif
Pfam: AIRS_C AIRS
Other DBs
NCBI-GeneID: 4334671
NCBI-ProteinID: XP_015631709
UniProt: Q850Z8 Q0DM29
LinkDB
Position
3:complement(34923905..34926711)
AA seq 398 aa
MAAAADRLLHLLRAAPASPAPAAVPSSRTRATFYHQPRSLRLAAGASGMRRVAVACSSAG
AGGSGVEGDEEGMTYKGAGVDIDAGTELVRRIGRLAPAIGGFGGLFPFGDQFLVAGTDGV
GTKLKLAFETGIHDTIGIDLVAMSVNDIVTSGAKPLFFLDYYATSKLDVDLAEKVIKGIV
DGCRQSDCALLGGETAEMPDFYKEGEYDLSGFAVGAVKKDKVIDGKNIMEGDIIIGLPSS
GVHSNGFSLARRVLEKSGLSLNDQLPRNDGMITTVGEALMAPTVIYVKQVLEIINKGGVK
GIAHITGGGFTDNIPRVFPSGLGAKIFTAAWEVPPVFRWIQEVGKIEDAEMRRTFNMGIG
MVLVVSKEAADGILEGTHGPNHAYRIGEVISGEGVHYV
NT seq 1197 nt   +upstreamnt  +downstreamnt
atggccgccgccgccgaccgcctcctccacctcctccgcgccgcgcctgcttccccggcc
cccgccgccgtcccgtcgtcccgcacccgagccaccttctaccaccagccgcggagcctc
cgcctggcggcaggggcatccggtatgcgccgcgttgccgtggcctgcagctccgcgggc
gcgggcgggagcggggtcgagggcgatgaggaggggatgacgtacaagggcgccggcgtg
gatatcgacgccgggacggagctcgtccgccgcatcggcaggttggctccagcgataggc
ggcttcggtggcctcttccccttcggtgaccaatttcttgttgctggaaccgatggagtc
gggacgaagctcaagcttgcgtttgaaactggtatccatgacacaattgggattgatctg
gtggctatgagtgttaatgacattgtgacttcgggtgcaaaaccactgttcttcctagac
tactatgctacgagcaagctcgacgttgatctagcagagaaggttatcaaggggattgtc
gatggatgccggcaatcagattgtgctctgctaggaggagagacagcagaaatgcctgat
ttctataaagaaggtgaatatgatctaagtggctttgctgtgggtgctgttaagaaggat
aaggtcatcgatggtaaaaatatcatggagggagatatcatcattggtcttccttctagt
ggggttcattctaacgggttctcccttgctagaagagtactggagaaaagtggactttcg
ttgaatgaccagctccccagaaatgatggcatgataactactgttggtgaagctctcatg
gcaccaactgttatctatgttaagcaggtgctcgagattattaacaagggtggtgtaaaa
ggaatagcccatattactggtggtggcttcaccgataatatcccaagagtatttccttct
ggacttggggcaaagatttttactgcagcatgggaagtgccacctgtattcaggtggatt
caagaggttggaaaaattgaagatgcagagatgaggcgcacgttcaacatgggaattgga
atggtccttgtggtaagcaaagaagcagctgatggaattctcgaaggtacccatggaccg
aaccacgcatatcgcattggagaggtgatcagtggtgaaggagtccactacgtctga

DBGET integrated database retrieval system