KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334674
Entry
4334674           CDS       T01015                                 
Name
(RefSeq) zinc finger matrin-type protein 2
  KO
K12848  U4/U6.U5 tri-snRNP component SNU23
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4334674
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4334674
Spliceosome [BR:osa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6.U5 tri-snRNP related factors
    4334674
 Complex C
   U4/U6.U5 tri-SnRNP related factors
    4334674
SSDB
Motif
Pfam: zf-met zf-C2H2_jaz zf-U1 SNRNP27 zf-C2H2 DUF4407
Other DBs
NCBI-GeneID: 4334674
NCBI-ProteinID: XP_015632398
UniProt: Q7G5X5 Q851A3
LinkDB
Position
3:34941604..34944655
AA seq 202 aa
MSSNPVGVDNTFRRKFDKEEYLERARQREREEKEEARKGKEKGPPVQRQPLKHRDYEVDL
ESRLGKTQVVTPIAPLSQQAGYYCKVCECVVKDSANYLDHINGKKHQRALGMSMRVERAS
LEQVQKRFESLKKRKDPGSFSEQDLDERILKQQQEDEERKRQRKEKKKEKKKELAAQNEP
EEDIDPDVAAMMGFGGFRSSKK
NT seq 609 nt   +upstreamnt  +downstreamnt
atgtctagcaatccggttggtgtcgataacactttccggaggaaatttgacaaggaggag
tacttggaacgagctcggcagagggagcgggaggagaaggaagaagcgcggaaaggcaag
gaaaagggccctcctgtgcaaaggcaacctttgaagcatagggactatgaagttgacctt
gagtcccgtcttggcaagactcaggtggtaactccaattgcacctttgagtcaacaggct
ggttactattgtaaagtttgtgaatgtgtcgttaaagattcagctaactatttggaccat
ataaatggcaagaaacatcagagagcattgggcatgtctatgcgtgttgagagagcatca
cttgaacaggttcagaaaaggtttgagtcacttaagaagaggaaagacccaggtagcttt
agtgaacaagatttggatgagagaatattgaaacagcagcaagaggatgaggagaggaag
cgccaacgcaaagaaaagaagaaagagaaaaagaaagagctggctgcccagaatgaacct
gaggaggacatagaccctgatgttgctgccatgatgggtttcggaggcttccgttcctca
aagaaatga

DBGET integrated database retrieval system