KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334721
Entry
4334721           CDS       T01015                                 
Name
(RefSeq) ubiquinone biosynthesis monooxygenase COQ6, mitochondrial isoform X1
  KO
K06126  ubiquinone biosynthesis monooxygenase Coq6 [EC:1.14.13.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00130  Ubiquinone and other terpenoid-quinone biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    4334721
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.-
     4334721
SSDB
Motif
Pfam: FAD_binding_3 SE DAO Lycopene_cycl Pyr_redox_2 NAD_binding_9 NAD_binding_8 Pyr_redox
Other DBs
NCBI-GeneID: 4334721
NCBI-ProteinID: XP_015632145
UniProt: Q10AW2
LinkDB
Position
3:complement(35259397..35264570)
AA seq 516 aa
MLSRGRCFPAASRIRPLVRAFCDVPPSLQDAAAGVPSSQDHTEKVDDVKARPDELDIAIV
GGGMVGLAVACALSNMPLTKHLRVGIIDSNPALKSRNYLKKDGVPDSRVSTITPATISFF
RDIGAWDHVQQQRHAFFGKMQVWDYTGLGYTRYSARDVGKEYLGCVVENKVLCNSLLLRL
QEENGDIEKMIYPTRLISLALPSKSRQAPTREAISSGYPPEELNRSNLVKLELSDGQTLY
SKLVVGADGSKSNVRQTAGIKTTGWNYPQSAIICTVEHITENDCAWQRFLPSGPIALLPI
GDNYSNIVWTMSPEESLRHKSMSPEDFVKSVNNALDFGYGPHPHSGSLDYYMEKLFSDIG
STAASTKECFEVPPKAIGVVCERMAFPLSLKHSHDYISKRLALVGDAAHTVHPLAGQGVN
LGFGDAAALAKVIAEGVSVGADFGDISLLKRYENNRKAANVAMAALLDGFQKMYSVDFGP
LNVLRAAAFHGAQYISPLKKNIISYAMGDAKWPLFS
NT seq 1551 nt   +upstreamnt  +downstreamnt
atgctctccagaggaagatgtttcccggcggcgagtcggatccggccgctggtcagggcc
ttctgcgacgtgccgccttcgctccaggatgcggccgccggggtgcccagctcgcaggat
cacacagagaaggttgatgatgtgaaagctagacccgacgagctcgacattgctatcgtt
ggtggaggcatggtgggattggctgttgcttgtgcattgtccaatatgccattgactaaa
catctgagggttggcatcattgatagcaatcctgcattgaagtcaagaaattatctgaag
aaagatggtgtacctgattcaagggtcagtactattactcccgcgaccatatccttcttc
agagatattggtgcatgggatcatgttcaacagcaaagacacgctttctttggtaaaatg
caggtatgggattacactggactgggttacacaaggtatagtgcaagggatgtgggaaaa
gaatatctcggatgcgtggtggagaacaaggtgctttgcaactcactgttgttacgatta
caggaggaaaatggagacattgaaaagatgatctaccctactagactgatttctcttgct
ttgccatcaaagagcagacaagcaccaacaagggaagcaatatccagtggttaccctcca
gaagaattaaatcgcagcaatttagttaaacttgagctaagtgatggacaaactttatat
tcaaaactagtggtgggagctgacggttccaagtccaatgtaaggcaaacagcaggcata
aaaacaacagggtggaattatcctcaaagtgcaattatttgtacagtggagcatattacc
gaaaacgattgtgcatggcagaggtttctcccttctgggccaattgctctacttccaata
ggtgacaactacagcaatattgtgtggacaatgagcccagaggagtcattgcgccataag
tcaatgagtcctgaagattttgtgaagtctgtgaacaatgcattggattttggttacggt
ccacatccacactctggtagtcttgactattacatggaaaagttattttctgacattgga
agtactgctgcatctacaaaggaatgctttgaagtacctccaaaagcaatcggggtagtc
tgtgagagaatggcatttccattgtcgctgaagcattcacatgattatatttcaaaaagg
ttagcactagtcggtgatgcagctcatacagtccatcccttagctggccaaggtgtcaac
ttaggttttggagatgcagctgctttagcaaaagttatcgctgaaggagtttctgtgggt
gctgattttggggatatttccttgctcaaaaggtatgagaataatcgcaaagcagccaat
gttgcaatggcagcgctgctagatggtttccagaagatgtactctgttgattttggaccc
ctcaatgtgcttagggctgcagcgtttcacggtgcccagtacatatcaccactgaagaag
aacataatctcgtatgcaatgggcgacgcgaaatggccgctgttttcatag

DBGET integrated database retrieval system