KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334800
Entry
4334800           CDS       T01015                                 
Name
(RefSeq) elongation factor Tu, mitochondrial
  KO
K02358  elongation factor Tu
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4334800
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:osa03012]
    4334800
   03029 Mitochondrial biogenesis [BR:osa03029]
    4334800
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4334800
Translation factors [BR:osa03012]
 Eukaryotic type
  Elongation factors
   4334800
 Prokaryotic type
   4334800
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    4334800
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4334800
  Exosomal proteins of breast cancer cells
   4334800
  Exosomal proteins of colorectal cancer cells
   4334800
SSDB
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 Ribosomal_S8 DO-GTPase2
Other DBs
NCBI-GeneID: 4334800
NCBI-ProteinID: XP_015630440
UniProt: A3APT4 Q851Y8
LinkDB
Position
3:complement(35826422..35830215)
AA seq 453 aa
MAAAAVLRSHGARRILSYPTLRAAVISGPTALPDASAAAAAAPQQPPPLAGTLWARSMAT
FTRTKPHVNVGTIGHVDHGKTTLTAAITKVLAEAGKAKAVAFDEIDKAPEEKARGITIAT
AHVEYETAKRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSAPDGPMPQTKEHILLARQ
VGVPSLVCFLNKVDAVDDPELLELVEMELRELLSFYKFPGDEIPIIRGSALSALQGTNDE
IGKNAILKLMDAVDEYIPDPVRQLDKSFLMPIEDVFSIQGRGTVVTGRVEQGTIKTGEDV
EILGLTPSGPLKTTVTGVEMFKKILDHGEAGDNVGLLLRGLKRGDVQRGQVVCKPGTVKT
YQKFEAEIYVLTKDEGGRHTAFLSNYSPQFYFRTADVTGKVVLPDGVEMVMPGDNVTAGF
ELISPVPLEPGQRFALREGGRTVGAGVVSKVYS
NT seq 1362 nt   +upstreamnt  +downstreamnt
atggccgcagccgcagtgctccggagccatggcgcccgccgcatcctctcctaccccacc
ctccgcgccgccgtgatctcgggccccacggcgctaccggatgcgtcggcggctgcggcg
gcggcgccccagcagccaccgcctctggctggaaccctgtgggcgaggtccatggccacc
ttcacccgcacgaagcctcatgtgaatgttggcaccattgggcacgtcgatcatggcaaa
accacactcactgctgcgattaccaaggtgttagctgaggcagggaaggctaaagctgtt
gcttttgacgagatcgacaaggccccggaggagaaagcaagaggaatcaccattgcaacg
gctcatgtggagtacgagactgctaaaaggcattatgctcatgtggactgcccagggcat
gctgattatgtcaagaatatgatcactggagctgctcaaatggatggtggtattcttgtc
gtatcagctcctgatggccccatgccacaaacgaaagagcatattcttctggcccgacag
gttggtgtgccatcacttgtatgtttcttaaacaaagttgatgctgttgatgaccccgag
ctactagagcttgtagagatggagcttcgtgagctcctcagtttctacaagttccctggt
gatgagattccaatcatccgtggatccgccttgtcagccttacaggggactaatgatgag
attggaaagaatgccattttgaaactaatggatgcagttgacgagtatatccctgatcct
gtgaggcagcttgataagtctttcttgatgccgatagaagatgttttctctatccagggc
cgtggaactgttgtgacagggcgtgttgagcaggggacaatcaaaactggtgaagatgtt
gagatcctaggtttgactccaagtggtcccttgaagactacagttactggtgttgagatg
ttcaaaaagatactggatcatggagaggctggtgacaatgttggtcttcttcttcgtggt
cttaagcgtggtgatgtacagcgtggccaggtggtgtgcaaacctggtaccgttaagacg
taccaaaagtttgaggcggaaatttacgtccttacaaaggatgaaggtggtcgccacaca
gccttcttgtcaaattacagtccacagttctactttaggactgccgatgtcactggaaaa
gttgtgttacctgatggcgtggaaatggttatgcctggtgataatgtaactgcaggattt
gagttgatatcacctgttccccttgagccaggccagagatttgcgctgagggaaggaggg
aggacagttggtgccggagttgtttccaaagtttacagctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9270837
Entry
9270837           CDS       T01015                                 
Name
(RefSeq) elongation factor Tu, chloroplastic
  KO
K02358  elongation factor Tu
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    9270837
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:osa03012]
    9270837
   03029 Mitochondrial biogenesis [BR:osa03029]
    9270837
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    9270837
Translation factors [BR:osa03012]
 Eukaryotic type
  Elongation factors
   9270837
 Prokaryotic type
   9270837
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    9270837
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   9270837
  Exosomal proteins of breast cancer cells
   9270837
  Exosomal proteins of colorectal cancer cells
   9270837
SSDB
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Other DBs
NCBI-GeneID: 9270837
NCBI-ProteinID: XP_015627061
UniProt: A0A0P0VL59 Q6ZI53
LinkDB
Position
2:23111942..23113725
AA seq 467 aa
MASLASASASTSLVFSTSSSKPRLGSSVGFSSPARFRRTAAAAASRGTGRRAGLLVVRAA
RGKFERTKPHVNIGTIGHVDHGKTTLTAALTMVLASVGGSAPKKYDEIDAAPEERARGIT
INTATVEYETETRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSGADGPMPQTKEHILL
AKQVGVPKIVVFLNKKDQVDDEELLQLVELEVRELLSSYEYDGDEVPIVAGSALKALENL
MANPAIKRGDDEWVDGIFSLIDSVDNYIPVPQRQTDLPFLLAVEDVFSITGRGTVATGRI
ERGTVKVGDTVDIVGIRETRNCTVTGVEMFQKTMDDAMAGDNVGLLLRGMQKDDIERGMV
LAKPASITPHTKFDAVVYVLKKDEGGRHSPFFPGYRPQFYMRTTDVTGNVTKIMNDKDEE
AKMCMPGDRVKMVVELIQPVACEQGMRFAIREGGKTVGAGVINTILK
NT seq 1404 nt   +upstreamnt  +downstreamnt
atggcctccctcgcctccgcctccgcatccacctccctggtcttctccacctcctcctcc
aagccgcgcctcggctcctccgtcggattctcctcgcccgcgcggttccggcgcacggcg
gcggcggcggcgtccaggggcacggggcggcgcgcggggctgctggtagtgcgcgcggcg
agggggaagttcgagcggaccaagccgcacgtcaacatcggcaccatcggccacgtcgac
cacgggaagactacgctgacggcggcgctcaccatggtgctcgcctccgtgggcgggagc
gcccccaagaagtacgacgagatcgacgcggcgcccgaggagcgcgcccgcggcatcacc
atcaacaccgccaccgtcgagtacgagaccgagacccgccactacgcccacgtcgactgc
cccggccacgccgactacgtcaagaacatgattaccggcgccgcgcagatggacggcgcc
atcctcgtcgtctccggcgccgacgggcccatgccgcagaccaaggagcacatcctgctc
gccaagcaggtcggtgtccccaagattgttgtcttcctcaacaagaaggaccaggtcgac
gacgaggagctgctccagctcgtcgagctcgaggtccgcgaattgctctcctcctacgag
tacgatggcgacgaagtgcccatcgtcgctggctccgcgctcaaggcgctcgagaacctc
atggccaaccctgccattaagcgcggcgatgatgagtgggtggacgggatcttctcgttg
attgattccgtggataactacatccctgtcccacagcgccagaccgacctcccgttcttg
cttgctgttgaggatgtgttctccatcaccggtcgtggtaccgttgccactggccgtatt
gagcgtggcaccgtcaaggttggggacacggtcgatatcgtcggtatccgggagactcgc
aactgcacggtgactggtgttgagatgttccagaagaccatggatgatgcgatggctggg
gacaatgtcggcctgcttctccgaggtatgcagaaggatgatatcgagagaggcatggtg
cttgcgaagcctgcttccatcacgccacacaccaagtttgatgcggttgtgtatgtcctg
aagaaggacgagggtggacggcactcaccgtttttccctggttaccgccctcagttctac
atgcggactaccgatgtgacggggaatgtcacaaagattatgaacgacaaggacgaggag
gcgaagatgtgcatgcctggtgaccgtgtcaagatggttgtggagctcatccagcccgtc
gcttgtgagcagggaatgaggtttgccatccgtgagggtggaaagaccgtcggtgccggc
gtcatcaatacgatcttgaagtaa

DBGET integrated database retrieval system