KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334824
Entry
4334824           CDS       T01015                                 
Name
(RefSeq) exosome complex exonuclease RRP46 homolog
  KO
K12590  exosome complex component RRP46
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4334824
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4334824
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Core exosome factors
     4334824
SSDB
Motif
Pfam: RNase_PH RNase_PH_C
Other DBs
NCBI-GeneID: 4334824
NCBI-ProteinID: XP_015630424
UniProt: Q84T68
Structure
LinkDB
Position
3:complement(35979769..35982427)
AA seq 238 aa
MEESRADGRNPNQLRPFSCTRNPLDRAHGSARWAQGDTIVLAAVYGPKPGTRKGENPEKA
SIEVVWKPMTGQIGKQEKEYEMTLKRTLQSICLLTVHPNTTTSVILQVVGNDGSLLPCAI
NACCAALVFAGIPLKHLAVAIGCGVLEDGEVILDTNKAEEQQLKSFAHLVFPNSRKSASS
KEPNQKEEDSERGLITSITHGVMSEEDYFSCIERGLAASSRISDFMRTTLQKQAPGDV
NT seq 717 nt   +upstreamnt  +downstreamnt
atggaggagagccgcgcggacgggcggaacccgaaccagctccgccccttctcctgcaca
cgcaaccctctcgaccgcgcccatggctccgcgcggtgggctcagggggacaccatcgtg
ctcgccgccgtgtacgggccaaagccgggaaccaggaagggggagaatcccgagaaggca
tccattgaggtcgtctggaagcccatgaccggccagattgggaagcaagagaaggagtat
gagatgacgctcaagaggacattgcagagcatttgcctgctcactgttcatccaaacacc
accacctctgtcattcttcaggttgtgggcaatgatggttctcttcttccatgtgcaatt
aatgcttgctgcgcagcccttgtttttgctggcatccccttgaaacatcttgcagttgca
attggttgtggagtactggaggatggtgaagtgattttggacacaaacaaagcagaagag
cagcaattgaaatcatttgctcatttggtgttccccaattcacgcaagtctgctagttca
aaagaaccaaaccagaaagaggaggattctgagagaggattgataacttccattacccat
ggagtgatgtccgaggaagattatttcagctgcatagagaggggccttgctgcatcgtca
cggatctcggattttatgaggacaacattgcagaagcaggcacctggagatgtctga

DBGET integrated database retrieval system